SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE13706 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE13706
Domain Number 1 Region: 105-156
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000000000852
Family Retrovirus zinc finger-like domains 0.0014
Further Details:      
 
Domain Number 2 Region: 24-55
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000089
Family Retrovirus zinc finger-like domains 0.0037
Further Details:      
 
Domain Number 3 Region: 54-90
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000331
Family Retrovirus zinc finger-like domains 0.0042
Further Details:      
 
Domain Number 4 Region: 2-25
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000009
Family Retrovirus zinc finger-like domains 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE13706
Sequence length 158
Comment (Caenorhabditis remanei)
Sequence
MSDQSCYKCQQPGHISRNCPQREQDGGRRGGGGSTCYNCQETGHFSRDCPKGGSGGGQRD
RNSGGGGGGGSCYNCGGRGHYSRDCPSARSEEGSGSRGYGGGGRGGGSRSFGGQKCYNCG
RNGHISRECTESGSAEEKRCYNCQETGHISRDCPTTNN
Download sequence
Identical sequences E3NBS8
31234.CRE13706 XP_003094150.1.11157 CRE13706

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]