SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE13745 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  31234.CRE13745
Domain Number - Region: 225-257
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00022
Family Retrovirus zinc finger-like domains 0.005
Further Details:      
 
Domain Number - Region: 78-171
Classification Level Classification E-value
Superfamily Apolipoprotein 0.0732
Family Apolipoprotein 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE13745
Sequence length 355
Comment (Caenorhabditis remanei)
Sequence
MGRTKNNKLDRTFDSGPLVPGNNDSTAQDDQNKENQDQGDKTALDISHEEVVETVDEVID
GVSLDHTQVLQPVWDTSALHEEIRETSELVRDVLDRVDSSEAVGDLVKDVLDRLDSPANV
KVQEVVPLLHHEMKKIGKLITKNGEEAQATRIKEAETMLEKYEALVTKVMTAAQNQQTGL
ATTIVRSVESKMTEIVAPLKSEMSRIVAYIAGITQQNERPLRDSKERDRSHNSNSTAVCV
FCEKRGHSSQDCKTILTPSDRWATARTKSICTKCLSKYSERGNGHTDCSKGDIICSQCSS
IMADTTLCAHHEAFCGVKKTAVRRRQDVPSARAPKMAKYSLDNRNKAGPSGSAPQ
Download sequence
Identical sequences E3NH61
CRE13745 31234.CRE13745 XP_003092268.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]