SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE13834 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE13834
Domain Number 1 Region: 188-289
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.7e-20
Family Voltage-gated potassium channels 0.0024
Further Details:      
 
Domain Number 2 Region: 56-129
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.98e-20
Family Voltage-gated potassium channels 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE13834
Sequence length 555
Comment (Caenorhabditis remanei)
Sequence
MSSLECSMDTLDEKLVKALDECYHVAVEHNTHVNHVLYENSKEEVESVGEESEEEIAEWS
FMDSLLFAFTVITTIGYGNVAPRTFGGRLFVIGYGLIGIPFTLLAIADLGKFISEMMVVA
KTFCKKTWKKLKKAWNPNFIRYPKLSGAKDLSNTDIEEKILENEKIENEIESSETSEEED
DLTETEATSLFILFLLYIAFGGMMLAAYEPDMDFFKAVYFNFVTLTSIGLGDIVPRSETY
MLITIVYIAIGLALTTIAIEIAADALKKLHYFGRKIENVGNVAIWFGGKKITMKALVKNL
GDQFNLPTTVVKSLNLDHFVDQAIKPDLERFDAEFADEPESEWIRDPTPTPPPSPQPVYR
LPSPKPKTPSPLPSPSITDKSMAIATPSPEESEDDEELILPSPEPSPIREPTPSPPPREP
TPREPTPEPEPYREPTPPPPPPPKPRPLTAAEIAAQKRKAYSEEAWRRYQEYQKQWKKFR
QTQKTPAPGASTSGASTSKQSGASPEGGGQAGTGSSTRSQSVTSVASGKTSRSATPESKK
SSHPSSSSRRESGAK
Download sequence
Identical sequences E3NS81
CRE13834 31234.CRE13834 XP_003088739.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]