SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE13883 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE13883
Domain Number 1 Region: 659-1130
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 4.89e-35
Family Reverse transcriptase 0.0065
Further Details:      
 
Weak hits

Sequence:  31234.CRE13883
Domain Number - Region: 223-257
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0575
Family Retrovirus zinc finger-like domains 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE13883
Sequence length 1206
Comment (Caenorhabditis remanei)
Sequence
MNYLPIDNRTKLQYLKTSVSGEAADILRNLPITNANFPIAMGILDDQYGGTVRIKHALLL
KLRKLPDLSSNTSPSDLQHLAIQAGMIFEQLGSMDCNIDNTTTSDIIESKLPKRVINKLY
GNGTEKYPTSTKQLILKIKEIAKVENLVAELHNNKSEGQRQVTMSTVAQINKRNHHGQGQ
QNNGNSHQSRQRATIPCAFCVEERMIHHPHLCRRYDSTTTRKQRANELHLCYRCLRSGHS
ARQCSKRCQHCHGNHHEAICLKLESGHQNGTSRNYSSSSGTNVTGHSSQRNGQQPAHAQQ
SQPVNMLTRNSNGNGSSHGNSSGNSNGHRGYQRKQYQHQRRFQNNREQTHLASAVEELSE
EEEEAVTHSINVTEENVDGNDSTTLETTVGINDMDNDSSDIKQLPVIMMAVELPILDSNG
RECYGTVFFDSGSNTSYISSAFSEKLKLTPTRTKKLRVNTFASNDSHSILSNVLQVPIKT
KKAVETVELCEVPHIASNIITVEINQEIYQHLLADQKIHLNRQQKDVDILIGLDHYLQVL
GQVNTLRLSNGLQLNITECGPIVSGKERPMKQILYDTYTAVNSKEDKLCQQLRKFWILES
IGITESNIHCQADEEANLYFRMTTKRNPDGRYVVRLPYSNKDNIPPNRALSYGRLQSAIR
RLKLDPGLLEKYAAIFKEQQELGFIEEVPDESTTDGPVVHYLPHHPVVKETSKTTKVRIV
FDGSAKSSKNKLSLNDHLHTGERLLPDIAGILLRIRQRNILISADIEKAFLQLELNIEDR
DSTRFLWIDTDNFQVKCYRYKRVPFGLKPSPFLLNKTIRTHLAIYDTKMAREMTHSLYVD
NVYMGVDSIDQAKQFYHESKEIFSEARMNLCQYVSNCKESNEYFNTIDKAKSQDRHQKLL
GIKWDTETDELIFSLPEMKAELVTKRRVLKRVAECYDPTGFLTPVILHGKLFFQTISTKE
NAWDTPLTDEQHKSWEKILQNWKGEEWRMPRKIFTDNLLMEADRIQLHVFTDASKIAYGT
VAYLRILKINQHSDAQFIMSKSRVTPINSNYSIPQLEALALLTGVRLANYCLKELNLTIE
QTFIWSDSMCSLDSLQSTSSSGSRFVRNRVKEIQDTGKDFIFTHIPGKQNPADLLTRGTT
FEELKRSIIWIKRPEFLQSTSPLPLRTNSMEPAIKAITALNINQEPVIETERFSSFHRLL
RTFMII
Download sequence
Identical sequences E3NWM9
XP_003087192.1.11157 CRE13883 31234.CRE13883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]