SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE14065 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE14065
Domain Number 1 Region: 300-399
Classification Level Classification E-value
Superfamily Acid proteases 0.0000603
Family Retroviral protease (retropepsin) 0.018
Further Details:      
 
Weak hits

Sequence:  31234.CRE14065
Domain Number - Region: 240-274
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000293
Family Retrovirus zinc finger-like domains 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE14065
Sequence length 697
Comment (Caenorhabditis remanei)
Sequence
MSFSTERTKKRSSSVTSSEKSWAVQMNEVRLKERRKLVKGFTDFLESSGRMESDMYEALK
AACKGNERQSEVLVEPVKKYCHELRERFEELGGERWPLEIIGVMRENGVETVEELRELCE
KGVEMVPGGIVENAKKAQDELALLQDAWNEERETLFRELNKLKEEKRLAEEAVSKYKKTL
KEEREASSELRGLLRKLENGPKKAGQARDTKEVPVPSRLEVVRKWSPRDSDDEFSMHGRR
GDRKTVGERRDSGAKMKCFTCGGIGHGSWQCVSKRVDKVQIQEGTVKNAGVETVEMVEML
GQRRRVVIDSGAVVSVMSTSAYERLKAGCRDWEKEVEVFGKPTFTVLNASNSKMRVRGQI
KIPMVVRGRKVRVVFQLVENWVEKILIGTNAFESIGVELKWKDPYGLVNAEENSAEVQFI
GGEKKLERPGEKLRKVPTEVSEIQCKSVAVRGERGRSASTGDVGEVFKSEGEKERKKVKI
RASVAVIGPRLEARGPGVLEYRNKTMTGWTQKFDWGEVKEAVVLVEYTDKEDENSKRVEF
VKSVAKEVEKVWMMPRRLQCEFGDVDNVARRWKEWLKTSANVEVVDPLMPVGNHKTPLIL
EKWHRKSLDGLQKYLHNALPSHSVRCQWEKNEDRRPQSGLKKDLGKGCPIAERRGKWLRR
SSTFSKPIGREETKGEKARGSWTTQATSKADVKVNFP
Download sequence
Identical sequences E3MRC1
CRE14065 XP_003101253.1.11157 31234.CRE14065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]