SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE14299 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  31234.CRE14299
Domain Number - Region: 818-917
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.000147
Family Reverse transcriptase 0.011
Further Details:      
 
Domain Number - Region: 475-545
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00225
Family beta-sandwich domain of Sec23/24 0.063
Further Details:      
 
Domain Number - Region: 573-599
Classification Level Classification E-value
Superfamily Acid proteases 0.0281
Family Retroviral protease (retropepsin) 0.025
Further Details:      
 
Domain Number - Region: 372-397
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0523
Family Retrovirus zinc finger-like domains 0.0078
Further Details:      
 
Domain Number - Region: 408-428
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0628
Family Retrovirus zinc finger-like domains 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE14299
Sequence length 1053
Comment (Caenorhabditis remanei)
Sequence
MSITLDDIKNWEEIISTHQEDYEKFLKASFQALKAVPNPATEPQTPVQDFLAGYAVFMAS
EVETIKPKDELYKTQLATVLENIHMTPVGTLLTETAKQASIKINKKDREITKLVGDIEAR
MDKRHEHLNTLAATHKVKGLADTSYSIRPRRSQTNVELKTDFIRPPGNNIQVSSFTTETR
PTMLQYKHVKLPTFNGNISEWPAFYMIFKPTVLENDEYTDVEKHNILRNHLVNEPADLIR
AYDPDGTQLATAVKRLVAMYGSTEKQYDYLWNRLNEVPMARDSPRSLRILHNELHAIINS
LSKHGSIETQNFQSVIKSKIPRNILIEVLRTKPKNTSAILEALDIIITIEESAQRSEMKV
NEKEDRNVFSVRKPQQNRKCRFCQRTNHTSAECKTVASLEDRREFIKMNNLCFNCLNSGH
RLSECKSSECRKCQVKHNQAICHRNSNVVRKNNFQKNPPTYKSQNENYRKNNFSNQNNGY
QSSNAAAYQQRNQGTQGQGYQQRNQSQPVNQRIQNNGNQTNGNQSNNGYNKRNQGQSPPQ
KSLKTRNYQVNANKTSLMVVNAPIVVGEEIEKIPVLLDTGADQSFILSSFAEKAKMEVLE
RNVEIDLCVFGKDPTSIISNVVKFEIITNDDSVIKVEALTVPDITDLFEPINLTHEDKKY
LENVNEKTVNITRPEKAVALLGLDVFWDLITDEGKKKLPSGKFIIPTHIGPLVCGKPERS
TSSMHALIARIKDSQEEHFTENDFQEYFEISNIGITDKVFDPTNEEIIVEFENKVETNSE
TKRIIAPLTWKEGQREKLANNYDVAICRARQLVRTSKGTEAWQKLEENFDTMEKTGIIEE
IDNDPNLGYYIPYGLVFNKSSNTTKVRTVFDASSKKRGEISLNNALHQGPSLIPDLQGIL
LRLRQGKYLLAGDIEKALKGLHHPAVSEFKESPRQVTPLDNQKQCKSVTRDVDKFHCSTS
NSSNSIPHHSASSSTDFAATPIPDNPKYVYVPKRPGKNAIRDVTSGGPCTSKPVSSPRAN
MTLLVMNMHTTDEFTLWYQIEKNRDECRVWTSG
Download sequence
Identical sequences E3NEX4
CRE14299 XP_003093041.1.11157 31234.CRE14299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]