SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE14522 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  31234.CRE14522
Domain Number - Region: 33-71
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00246
Family Retrovirus zinc finger-like domains 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE14522
Sequence length 231
Comment (Caenorhabditis remanei)
Sequence
MYIEENITLEEDLELLMKGKNEPKEKADNPKKDRNQSNKSDRSEKQKKTRLCLFCKDSEH
HSSKCTKFVSIKDRKDFLNREGRCLNCHSNAHKTAECYSTRPCYFCKGRHSSVLCTNRGE
SSSPSSAISSRDSKHNQQAKTKVKTATTNVTHTEEVEEAVQCETQTTERAPTTTSKAFVP
TIQAKARNKVSGEWTTISTHYTTENLWIAYSEGTREVQRSLHCRLHRKRVS
Download sequence
Identical sequences E3M9C8
XP_003107201.1.11157 31234.CRE14522 CRE14522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]