SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE14529 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  31234.CRE14529
Domain Number - Region: 337-368
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00023
Family Retrovirus zinc finger-like domains 0.0051
Further Details:      
 
Domain Number - Region: 518-579
Classification Level Classification E-value
Superfamily Acid proteases 0.00457
Family Retroviral protease (retropepsin) 0.035
Further Details:      
 
Domain Number - Region: 383-414
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0994
Family Retrovirus zinc finger-like domains 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE14529
Sequence length 929
Comment (Caenorhabditis remanei)
Sequence
MSLAYRQGRVTMAIKALKEVRDIANANIDSWRDMEEEDLMSNQKDIFGAQSLMESKLSTL
DTAMDKFLLEADKIDDSDPIALRKIDESSTRVIEAVDEANKVLDQVLVQVRRITAATQKR
TTPETPSLSHQLQPVIIHSESRLDPKPPRFKGNRWEFENFWTLYSATVENSGKSNTLKFN
YLLNCLKGEPKEWISRFKINDENYPLAVEMLKKKYNDKEQIISDLSNQIQKETAPSASIA
DQRKLFEKLFIMTAQLKDYHENIETRMFKDQIVQKFSKSIRSELYKKKIDMDSTEWTVDQ
IMKDLETIISREEELNKLMKCSDSEYQNNPKTQSFKNDSKKDESDSKKTSSMKCTFCRQE
GHWGSNCEIHSSPEERMEILKSENRCLLCTRFGHSIDVCRSKACSICQKNHHFSICYSTN
DDSASHKKQSEQKAKTQSSNESYTPKVQAVFVQSSRNDGSFHDSSQDETKEDCMCPAEKK
DDQSDMPTASSDNKEEFETFIPTIQVNAFNPKKNCWDPISMMLDSGASNTHTDMKMFEEW
NLPDKGQKTVWNRVFGSAQSTVNTHQKTAVRIQLGQELLDMDIFVSDHLVGRIPKNDLPI
EDMKFIIQNALVMNQDALKSTCQPQIIIGCDYMSKIMTGQFIKFPSGISALGTACGLTTM
GRSASKIKKKEQHLLMVIKDSDQGYTFSRLHQEQKERGITERVEFPRDKSGKSENSNGRL
GPSDLQDSAKEPILLKPNSDLTAQIDQGHFLPHDRLGKGSEPEVTCSLFKRPAATSLHLH
LPPVMKEDEEGPVNRKVLIPKKSPTRDRTPIQVEDSIPPEAPDQKVSRRLASRSPSDKSR
RRHSSSSSSSSSSSSSSSSSSSSSSKRTSRRHSRSSTHVSNGHATRVTRPRKQTDNQGFR
LDLRSTIGLSTTIGLSTTMGQSTSSHPLL
Download sequence
Identical sequences E3M9D6
31234.CRE14529 CRE14529 XP_003107296.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]