SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE14582 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE14582
Domain Number 1 Region: 45-144
Classification Level Classification E-value
Superfamily Acid proteases 0.00000915
Family Retroviral protease (retropepsin) 0.017
Further Details:      
 
Weak hits

Sequence:  31234.CRE14582
Domain Number - Region: 2-19
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0111
Family Retrovirus zinc finger-like domains 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE14582
Sequence length 444
Comment (Caenorhabditis remanei)
Sequence
MKCFTCGGIGHGSWQCVSKRVDKVQIQEGTVKNAGVETVEMVEMLGQRRRVVIDSGAVVS
VISTTAYERLKAGCRDWEKEVEVFGKPTFTVLNASNSKMRVRGQIEIPMVVRGRKVRVVF
QLVDNWVERILIGTNAFESIGVELKWKDPYGLVNAEENSAEVQFIGGEKKLERPGEKLRK
VPTEVSEIQCKSVAVRGERGRRASTGDVGEVFKSEGEEKERKKVKIRASVAVIGPRLEAR
GPGVLEYRNKTITGWTQKFDWGEVKEAVVLVEYTDKEDENSKRVEFVKSVAKEVEKVWMM
PRSLQCEFGDVAKVTEKWKIWMEKSVNVEVVDPLMPVGKHKIPLILEKWNQKSLDGLRQY
LRMALPNNSTGCQLKKDETLGQDTTIWIGESLRKRTPDRREEGEVASPRFFSHETHWKRR
NQRREGTWNPDDPSHVKRSNMNSS
Download sequence
Identical sequences E3M9N7
XP_003107248.1.11157 CRE14582 31234.CRE14582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]