SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE14678 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  31234.CRE14678
Domain Number - Region: 636-650
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00502
Family Retrovirus zinc finger-like domains 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE14678
Sequence length 749
Comment (Caenorhabditis remanei)
Sequence
MVVEVQLIGWKVKIFAPLQSMKLERTSNSEKEGGVAAGVATSEVGTWDDHRVIPPTNACG
AGEASTVIHTQPKDASGVNPSIIQNPTEAGGISGVGSDANLIVTQLKEIGEIRDLKSLSD
TDGTWKHQLLGYTEKPVKETEEDNGKDSVPRKTSEDDKNRAFPTGRKNLATTWDAVDTIQ
AEQPSNLVSRTGQMNRASLEAGRASHLVDSPSTKTKCLERKVSETCLCSGVVDMVGKWDD
HRVISPTTPTSPRARSLSSNRGLRPQILHTPVVVRQQGVSRDESAADMDWSQRLIDASEG
IMENSHPPMANNLTPIRNGSPQSEEEKDESMPHVNPDITSPNPEDVQAAVTASGGTTSPG
STPPLRLSNGNFPKIQEAVASEAIDEDEVETNQVNQRRAEINEEEGFPPHVMAPSFKSAT
SDHLVTINPDASQEDSRRAFLTVLKYRARRRAESMLIEKPESTLNELVQGLKEMFECTSH
VQRNKTHSRSSNELPGESSADSLFHRTIKLAKQSYHEYQKNLEYQNEDVTLEKFLEGLNQ
AIKSLAIREARPITDQTRSTALEGEARLVPNEQPLEPTQLPAQLEASLANTATDHGDRDD
CRDHRSERQGRDDDYSGRSSAIDSQVSRREIFLTFTGKCHYCGKVGHMARSHNLKQRTVA
NQQKSKDPASNHQAIQVDAEEEASCLREMILWQDLRIHELKEWNDRLRRDNSSATSRDQT
SQADPPSAMALWTMFGQKNKFPRSKFNLV
Download sequence
Identical sequences E3M9I7
CRE14678 31234.CRE14678 XP_003107308.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]