SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE15030 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE15030
Domain Number 1 Region: 282-324
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000953
Family Retrovirus zinc finger-like domains 0.0017
Further Details:      
 
Domain Number 2 Region: 352-403
Classification Level Classification E-value
Superfamily Acid proteases 0.0000884
Family Retroviral protease (retropepsin) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE15030
Sequence length 412
Comment (Caenorhabditis remanei)
Sequence
MSDAEMNRKFIEMMEFMQKQMAEQAKKHEETIAVLTKAVAEKSQIDGSLGTSSGLTVSQS
QLMNDIGGRISVFQFDLETEKTFSKWYARYSTAFTEEGKGLDDKNRVALLVSKLSEEVYE
QYSRRICPKLHHEVDFKDTVDILKEMFDIKKSLFSHRFACINIARDGDSPVEYTNKVNSL
CELAMLKDIDPDGWKVFFWLRGLDPTQDTKARAYFLKYVERKTELGEKVNINELCTEWQK
IQSQTSAVSEMEKSDTAVRAVYAKRPSNQKQNSSKNTAKHESSQGERCWNCGKSGHKKPE
CFQPLTKCFKCQKSGHMSSFCKAKKSSSYKKTQNVAIVGGASSEDAEVNSVRQYVSVDVN
SESVEFQLDTVSDITLIGREDWTRIGKPDLEKCTSKVKSASGNELKLLGRAF
Download sequence
Identical sequences E3NKA6
CRE15030 XP_003091173.1.11157 31234.CRE15030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]