SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE15146 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE15146
Domain Number 1 Region: 161-189
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000598
Family Retrovirus zinc finger-like domains 0.0035
Further Details:      
 
Weak hits

Sequence:  31234.CRE15146
Domain Number - Region: 11-70
Classification Level Classification E-value
Superfamily Acid proteases 0.00135
Family Retroviral protease (retropepsin) 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE15146
Sequence length 292
Comment (Caenorhabditis remanei)
Sequence
MCSRLGLPEPEPPIKKTVIGFGNASVKIAGSRVITFTIGSYRINHRVHITAEPLGDYDFL
LGIDLLSRLPNIGFDLREAKMSIGKDVLPLGERAKCQECQRRSLENKTLKVQKSSWSEEA
HEGTYTDFVIVDSWAEEMESSQVQEAVESKPSKLTKRPKLQSTPKRKGTCHYCKEEGHFA
RECHKKAKLVASKKDQRPNPPTILDRGEDISSSHTQLAQEIETLRKQVEELFTLNRKLIS
ERFTSCEHTSAAPQRSTEVEKTEVEVEKTEEEQNVTSSGHCDQEQKDRQSSM
Download sequence
Identical sequences E3NTB8
CRE15146 31234.CRE15146 XP_003088354.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]