SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE15455 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE15455
Domain Number 1 Region: 654-680
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000698
Family Retrovirus zinc finger-like domains 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE15455
Sequence length 1109
Comment (Caenorhabditis remanei)
Sequence
MADIDEDEATRRAEEEANRLAEDERIRLENELLAEEPMEEGDEEKRVQEVRLEEIEKAIN
ETCTDIKNQTKFSTKQCRVLLSPLIGKILEVEEQFRGKKKESEFWEKMNVKMNETVLSLQ
NELERKSQQQPPTSLEEPTATSVFSGQSIQGNQERTKMVSLLEANEIHTEEELNKLFEKY
EQLEYELSVKVEYLQRSQRQTDSFRSELCRLKVKCDQQQQKLLAEEEKAKKMSEELKTKY
SNLRANSSTRVGECNQQTGERKESTRYYNAETSEIIETIPLQESLDSGRNWNQRIVEQNA
QRNIIVHNEHEMSNMNAQWRMAQALPDPPVFSAGKNSVNAETFERAFYMKYRFFDMEAQK
NFLETRFLSGNALTVYKGLPESDKNSVSRILDAIKRRLSQSEPEESRRAKSKFQALKLHK
EQTVQDFCLVMDEVVRIGYKGVPEYQISSMKTTKLLDEMREHTVFEVLLQILGSQLRNCP
VEEQYELCRVEATMFDEEWRSGKRKATQHEKRMNREHSDQYSNNVPRTGFTKNNASVSQQ
SSRVNRYTPIRQSNSYQTNSGSDSNSNQCTSTTSQQQNFSTSNDLNNQWAPKGYMYNEKS
PECWKNLAHSSDSANNASSNALGFHKCSECNQTGCHAPTCSRAPGSNTSKVKINSTIVCF
RCDQQGHIASKCPTRNASIQEVRMAPNVQSKVEDQKCKMKFDTKCSSDKESERKLIDHEM
ETKDLYEGQSVAASVFKKDMVIDVDRVPIKSINSIEFSVMSSDEMLRSGDTKDDGLQTSC
TKHAHTKDNSGGVNREFTEANSQKNGYCDEEHKSERDQRLCSISLTKTKKQSVQQKKVSD
VISSFGDLKRDQKEHNVQKNIVNYESTQSYMSSEDGDGKKKRNTVDQKAVDNVMCQGPPL
NFIENSSSLNQYDNVDANEATDIVKINTSKSKFLNQKCPKKPGLQKTGDDTCGVNFPKKS
KRRNKEETSPRTDPPVILRFDSDLWLHDTSQGSLDSDNDDQLDSYQKWKRAVPKMFKSQV
VPRPLKDPPTSTNQSTWSDTKFESAKESPRPLNDPPDSWMEDVNWRRMQEEYRPRKDPPS
PYCQHGHRNLLGCLQSTQFLPTPMSTVSS
Download sequence
Identical sequences E3MCG5
CRE15455 XP_003106315.1.11157 31234.CRE15455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]