SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE15552 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE15552
Domain Number 1 Region: 88-111
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000235
Family CCCH zinc finger 0.0049
Further Details:      
 
Domain Number 2 Region: 253-277
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000628
Family Retrovirus zinc finger-like domains 0.0052
Further Details:      
 
Domain Number 3 Region: 202-238
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000272
Family Retrovirus zinc finger-like domains 0.0062
Further Details:      
 
Weak hits

Sequence:  31234.CRE15552
Domain Number - Region: 167-191
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000122
Family CCCH zinc finger 0.0038
Further Details:      
 
Domain Number - Region: 142-167
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00209
Family CCCH zinc finger 0.0068
Further Details:      
 
Domain Number - Region: 61-83
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0118
Family CCCH zinc finger 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE15552
Sequence length 310
Comment (Caenorhabditis remanei)
Sequence
MIVVAQHLHDIQLNAMQKAFAPQTMTDLISNITAPMTDVEEALFNQRGMKEAPFRDLDRS
GRAVCRKNKLGICPFGPTCPLRHIDGEKAVVCKHWLRGLCKKGDQCEFLHEYDLTKMPEC
FFFSKYSACSNRECPFRHIDPETKMKDCPWYDRGFCRHGPYCKHRHRRRAVCPNYLAGFC
PQGPDCQYAHPSFGLPSFENITVSHAKPTYSQAITCHNCHERGHKATTCPHLPGQNRQSQ
DHHHRVDLSLIPDKKNLSDVTCYKCGEKGHYANRCHKGALAFLSNTAHLAHEQREKDEKE
QGRINNMLRP
Download sequence
Identical sequences E3MSW9
XP_003100707.1.11157 CRE15552 31234.CRE15552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]