SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE16117 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE16117
Domain Number 1 Region: 260-297,387-440
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0000213
Family Cytochrome c3-like 0.069
Further Details:      
 
Weak hits

Sequence:  31234.CRE16117
Domain Number - Region: 207-250
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0016
Family Retrovirus zinc finger-like domains 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE16117
Sequence length 632
Comment (Caenorhabditis remanei)
Sequence
MMQDDNPSYWHLEEVKKMYAIDQIDLARSLMALQGIDLTKSLNGPRGITPMLARLKRGIA
THEPITSSISNRLRYPQQSVIYSEQSEELQYFIKSIGFMRILQQAKEVLDGSIKDLQENP
DYRAQHMLKQLGTPPKTTESKDNTLDNVKKQKIKLHRVNLLDFVNKATDQAIMVIPKTEI
PCYEEVECKFCGSFCHVMEKCPTMLQKRFKTATQNRICMRCLEEGHTKEYCPSDIVCEEC
TGEHNTSFCTQEGDLAKIIGYVKVEWRNPCWYCHKQHMTMDCPWSHQSRRILVGIEKACE
MCLSRSHPTESCKPFKTCTFCQGYHNILHCHAMEMEKRVKQSIEDSWRYPDQLKEVEEYR
HQVRTQEMVELTQHIRTIQTPAMIEPCRYCNSAEHAAIYCEEDINVKALAVFVKNLCENC
LSDQHHAETCTNTKVCIICNGEHVHSSCEHRKDPGTIKPAQLKIVFTKDTSESTNKLKIH
PEEGKEQELQGEEIPEEVNIEKLSLDEQNTPKVARNERIKILSNESTISEEPKEGGSTTR
TDQNQFDRSPNITINSPTSKSSRIPTALEYPETSQQDQGKQSYYSETKSQGIVGQSTQSR
STVPDKVLQKRSQQTSGHTNNPGSPGQDNTQA
Download sequence
Identical sequences E3MBX5
XP_003106342.1.11157 31234.CRE16117 CRE16117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]