SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE16300 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  31234.CRE16300
Domain Number - Region: 189-214
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00418
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE16300
Sequence length 382
Comment (Caenorhabditis remanei)
Sequence
MTDPNTETINEDGQKLSEYGVLKDDKLPAMPVEGNTHEEPSADGKAIVSVKETEEAAKLR
ASQEEKILSIQTAYYLVAGKIDTLEKESEAHRDVLDQIATDQSNLSEKIDQQMSTKADLQ
CVQLGIEDEVSRLKEAVKELKHRLLGEPKESPLDCFSPSPFKIPKMSEKRGPTGEIEENS
SSITRKSLKDCPLCRDSGHRLADCPQFASKLEKLQQFRKRQICCTCGNLQCSRINCPKAT
IQCQICKGKQEFGKTLHISEICIFETHVSKRPSQTEYRRQKFSAQRPRSKSPAKENQAAT
QGPQPAQLQQQMVQQQYQQQPMMPPGPAFGPGYQMNPMIPPQQYQYQHPQQMVPMPMQPI
PLQQYGYYQQQPGPSNQTTHHQ
Download sequence
Identical sequences E3N7Z5
31234.CRE16300 XP_003095476.1.11157 CRE16300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]