SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE16319 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE16319
Domain Number 1 Region: 158-255
Classification Level Classification E-value
Superfamily Acid proteases 0.000000000000375
Family Retroviral protease (retropepsin) 0.011
Further Details:      
 
Weak hits

Sequence:  31234.CRE16319
Domain Number - Region: 91-135
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000733
Family Retrovirus zinc finger-like domains 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE16319
Sequence length 402
Comment (Caenorhabditis remanei)
Sequence
MKIMETRPTTTLIQLEHEIMKLLEFREDAKNIGGCKTSEEVFAVRKMRTEKANEQKRSSQ
RHLLRKEKQRENEGNSTDEKDDSDEEKPTRNHNQRKTKCHRCGGEHNAMNCWVKNKECFG
CGRRGHVSKMCQEQQDDDEKSDRLCHRAIYAEDDSYEKTRIYRTIEVNGLDVKMQVDTGA
DISFISREDWKRLRKPKLKRTKTEIFDSGGLKMPLDGAFKCKIKYQGVEKTVEAYVGDAK
SLFGLDWLKKIPDVLNIDKIWMNHIVAKTPNRRRDIYKVNGIYVKDSKPRKGSTEVVKIG
SMKRHVRRWPDEKFVKIQRNREETGKDRSRGWYQQGSSTPSLPIPPQPSFAMYPWRNSFG
CSEMTGRDVWIPNGYEIRMMSGPDANGRGFHQNDVAPVDFRC
Download sequence
Identical sequences E3N831
CRE16319 31234.CRE16319 XP_003095456.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]