SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE16970 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE16970
Domain Number 1 Region: 795-864
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000522
Family Rhodopsin-like 0.03
Further Details:      
 
Weak hits

Sequence:  31234.CRE16970
Domain Number - Region: 676-691
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00419
Family Retrovirus zinc finger-like domains 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE16970
Sequence length 896
Comment (Caenorhabditis remanei)
Sequence
MVVEVQLIGRKVKIFAPLQSMKLERTSNSEKEGGVAAGVATSEVGTWDDHRVIPPSNACG
TDEASTVIHTQPKDASGVNPSISQNPTETGGMSGVGSDANLIVNQLKEIGEIRDLKSLSD
IDGTWKHQLLGYTEELVKATEEDNGKDSVPRGLTETAREDCNVSASANKDGIATIDEKTS
EDDKKRAFPTARKNLATTWDAVETIQAEQPNNLVSRSGQMNRAIFEASRTSQLVDSPSTK
IQCLERKVSETCLCPGVVDMVGKWDDHRVISPTTPTSPRARSLSSNRGLRPQISHTPVVM
RQQGVSRDESAADMDWSQRLIDAREGIMENSHPPMANNMTPIRNGSPLPEEEKDESIPHA
NPDITSPNPEDVQAAVTASGGTTSPGSTPPLRLSNGNFPKIQEAVASEANDEDEVEANQV
NQRRAEVNEEEGFLPHVMAPPSKSATSLPAHENINNSVRSFRDHLVTINPDASQEDSRRA
FLTVLKYRARRRAESMLTEKPESTLNELVQGLKEMFECTSQIQRNKTHPRSSKQLPGKSS
DDSLFHRTIKLATQSYHEYQKNTEYQKEDVTLEKFLEGLNQAIKSLVKREARPITDQTRS
TALEGEACLVPNEQPPELTQLPAQLAASLANTATDHGDRDDCRDHRSERQGRDGDYKDRS
SENDFQISRREIFLTFTGKCHYCGKVGHMARSHNLKQRLVANQQKSKDPASNHQTIQVDA
EEEASCLREMILWQDLRIHELKEWNDRLRRDNSSSASRDQTSQADPPSAMALWTIFGQKN
KFPRSKFNLSTVPCIFLYFPSLIYFIFPIFNIELGLFSNIAGINFVIYPVLDPLAVIYII
KHYRCFVFKLFCLSHKIQPNVDAEQRKNDVVMASEVEIRTEGNNEIFMSFNRISSE
Download sequence
Identical sequences E3N2D3
XP_003097465.1.11157 CRE16970 31234.CRE16970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]