SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE17270 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE17270
Domain Number 1 Region: 459-892
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 2.78e-124
Family Reverse transcriptase 0.0000901
Further Details:      
 
Domain Number 2 Region: 1072-1228
Classification Level Classification E-value
Superfamily Ribonuclease H-like 3.79e-41
Family Retroviral integrase, catalytic domain 0.0044
Further Details:      
 
Domain Number 3 Region: 324-417
Classification Level Classification E-value
Superfamily Acid proteases 0.000000000000246
Family Retroviral protease (retropepsin) 0.014
Further Details:      
 
Domain Number 4 Region: 259-303
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000534
Family Retrovirus zinc finger-like domains 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE17270
Sequence length 1385
Comment (Caenorhabditis remanei)
Sequence
MPDSKDTTTGDQAMAMADLTRQISSLLEAFSKMAQATGTSTGSSSVSNTSSQLVESLSTR
IPMFAYEPDEDKTFDSWYSRYEDIITKDGSSLTDDAKARLVLAKLNAKEYSHFANRILPT
LPNALGFTDLIQKLKETFKSTSSIFRKRQDFLRTEYNGSAIEEYTGLVLRRFTSSEFKKM
SDDQICCMVWINGLRDNSYSDIRTKALQVMEAKPNCTLLELEQDIKRLLDVRADSKSVSK
VEAVSNEINAIHNAIKRDKSQKAPPSPCYKCGGSHWAKECSKKVTCSNCNKNGHIAKFCR
SKQRDSSKVHKKVRSVVISTASTSGSSRIYRIISINGKKIQMQLDTGADVTLLSIKDWNR
LGRPQLQAPSIKVKSANHQPIAVKGSFQCNFIINGNSATGQAHVAETGTLLGTDWIAKDT
KLWQLLNNNQVNAVRSDVGSACDYLDGSREQLKIDLKKEFDHVFQPGLGLCTKTKASLLP
KPDAQPVFRKARPVPYAALTTVSDELERLQQAGVISPVDHSEWAAPIVLVKKKNGSLRMC
ADFSTGLNDAIQQHQHPLPTADDIFSTLNGGKYFSQIDLAEAYLQIEIDEQAKQMLCINT
HRGLYRYNRLPFGVKSAPGSFQQIMDSMTSGLDGVAAYLDDIIITGSSVAEHNQRLETVM
SRIQDFGLRVRIEKCTFLSPKITFLGFIIDKDGRRPDPEKVSAIRHMPVPQNESQVRSFL
GLIQFYGSFVKELFKLRPPLDALTKKDVEFKWTSECQNAFDHIKQILHSDLLLTHYDPKL
PIIVAADASQYGIGAVISHRFPDGSEKAIYHISKALTAPQRNYSQIEKEAFGLITAVTKF
HRFIHGRHFTLRTDHKPLLSIFGEKKGIPVYSANRLQRWAIILLNYDFNIEYINTHDFGQ
ADALSRLISEQIQQKECEDRVISQIESEVVTNLVSTCEQLPVTADMVRSYSRKDKLLADV
FQYTISGSWPKIIEKNSQISLFHNRRDQLSIVSDCLMFNDRIVIPTSLRPRVLKMLHRAH
PGIVRMKQLARTLVYWPSIDKDIERIVRSCDQCAAVAKDPVKNTLCSWPISTAPWQRVHI
DYAGPIDGTYFLVIVDSYSKWPEVIPTSSITATATINIMRKLFAQFGDPETLVSDNGTQF
TSTQFAEFCIQRGIRHTRSPPFHPQSNGQAERFVDTLKRALGKLKGEGTTDTALYLFLQS
YRSTPCTASLNGSTPAENFIGRKIRTYLDQLLPNDQLTVSHDTEMEEQFNKQHGARPRNF
QKEEKVYVKDYRNINTASWIPGTIQSRIGKTLYKVLVNDTTWIRHSNQLRRRDDPIKDVP
LDALDLMDFMPSPTTRPDNFINAPAKVKTPVKPRTPSPPPQLRKSTRNVKSPSKFIVKPS
LKSYR
Download sequence
Identical sequences E3MAG5
CRE17270 XP_003107007.1.11157 31234.CRE17270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]