SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE17304 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  31234.CRE17304
Domain Number - Region: 677-691
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0044
Family Retrovirus zinc finger-like domains 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE17304
Sequence length 790
Comment (Caenorhabditis remanei)
Sequence
MVVEVQLIGWKVKIFAPLQSMKLERTSNSEKEGGVAAGVATSEVGTWDDHRVIPPTNACG
AGEASTVIHTQPKDASGVNPSIIQNPTETGGIPGVGSEANLIVNQLKEIGEIRDLKSLSD
IDGTWKHQLLGYTEKPVKETEEDNGKDSVPRVLTETAREDYNVSASANKDRIATIDEKTS
EDDKNRAFPTGRKNLATTWDAVDAIQAEQPSNLVSRTGQMNRASLEAGRASHLVDSPSTK
TKCLERKVSETCLCSGVVDMVRKWDDHRVISPTTPTSPRARSLSSNRGLRPQILHTPVVV
RQQGVSRDEPAADMDWSQRLIDASEGIMENSHPPMANNMTPIGNGSSQPEEEKDESIPHA
NPDITSPNPEDVQAAVTASGGTTSPESTPPLRLSNGNFPKIQEAVASEANDEDEDEANQV
NQGRAENNEEEGSLPHVMAPSFKSAASLPAHEDINNSARSFRDHLVAINPDASQEDSRRA
FLTVLKYRARRRAESMLIEKPESTLNELVQGLKEMLERTSQVQRNKTHPRPSKQLPGESS
DDFLFHRTIKLATQSYHEYQKNTEYQKEDVTLEKFLEGLNQSVKSLAIREARPITDQTRN
TTLEGEARLAPNERPLEPTQLPAQSEASLANTATDHGDRDDCRDYRSERQGRDEDYRGRS
SEIDSQVSRREIFLTFTGKCHYCGKVGHMARSHKLKQRSEANQQKSKDPVSNHQVIQVDA
EEEASCLREMILWQDLRIHELKEWNDRLRRDNSSSTSRDQTSQADPPSAMALWTIFSQKN
KFPRSKFNLV
Download sequence
Identical sequences E3MS14
XP_003101033.1.11157 CRE17304 31234.CRE17304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]