SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE17330 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE17330
Domain Number 1 Region: 4-91
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000472
Family C-type lectin domain 0.025
Further Details:      
 
Weak hits

Sequence:  31234.CRE17330
Domain Number - Region: 154-194
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 0.0502
Family Glycosyl hydrolases family 32 N-terminal domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE17330
Sequence length 227
Comment (Caenorhabditis remanei)
Sequence
MVALLLLFLTLPVAVFTKDVKCPEGFLHFKRTPTAKNNHTKNWCMKVSVYENVGNRDNAR
SVCLADNATLTIPENREEYEAISAYIRKANISEPHAIDGQISQKCKLKMFRHQRLRLEIN
TTRWTGDCNIKKNLFTFDDVNTDTTFALTQFEWSVPNGQGATQHDRDPKLFWVDECLKMS
QTHYTGNRTGLPFVDLSWCMGVDGTDKSDWRFKYRVINSVLCGRRPL
Download sequence
Identical sequences E3MRY2
31234.CRE17330 CRE17330 XP_003101021.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]