SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE17428 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE17428
Domain Number 1 Region: 776-1206
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 6.45e-33
Family Reverse transcriptase 0.006
Further Details:      
 
Domain Number 2 Region: 1499-1659
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.88e-21
Family Retroviral integrase, catalytic domain 0.022
Further Details:      
 
Weak hits

Sequence:  31234.CRE17428
Domain Number - Region: 365-423
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000112
Family Retrovirus zinc finger-like domains 0.0049
Further Details:      
 
Domain Number - Region: 527-559
Classification Level Classification E-value
Superfamily Acid proteases 0.0716
Family Retroviral protease (retropepsin) 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE17428
Sequence length 2978
Comment (Caenorhabditis remanei)
Sequence
MSLRAPRGNVTKAEQALKDACDNAFVSINELKELGDEELKGKSREMDSHLIRLEVKSKKL
IEYMEALTAASGDMEDQEDQDAHDAYATKVNDMLEQADHMTTELKVLQGLSQKMSIEKKI
EEKAGDEKKTHGTTPSSIHPESTELIRALVQQMNQPKQLELPPVPTFDGKIWEFDNFMTI
FKIVVDTSAQDPMLKWTHLINHLKGPAKDLVMKIKPSSESYKQALDVLQKTYGNPKRIHK
ELTQRLKREEAHSSRTSDQRKLIDRITVLIHQIEEIDENIESSTKEMILTKFDQRIQEKV
INKQIKSEEEGDSEWDTKTILKTIEKYIAREESLIERCPQSALNKIPVQKKEDQQKKEKK
IFHKDDTKKPERKRICQFCKDSGHWGFECNKITSIKDRTDILNTEGRCLKCTRKGHKLSE
CPGKPCFLCQKDHHSSICFKNKDENANKKKEATQSEAAVKDKSKSKTTAVTHTCPAENKG
HPNFERSKEEEEVTTGTTKSSEETKGQAYIATFQIQAFNQKSWEWEPISAMYDSGADQTY
ISRSLMEQFGLTIEGEDTFNNFTFGNEQSFEATYARTRIRVKTDHEQHELQVYAINKLIG
KIRKPTLTEEDLKFIKKNDLKINMDSFEKEVQPQMILGSDYLDELVEGSLQRLPSGLNLV
KSKMGLATLGRYRNQKGPQDKPKDMYQFAVVEEIIDKDRETEDEQIKDTQMKEPHEFTGP
TEQERSEKDKETADRFEKTIEKRADRYYVRLPLKIDHLPLPDNWKIALKRLVSLKRQYTE
DILELIQEVFNDYLSQGFIEEVDRSKDKDNLKHYNPIQAVITPQKTTTKCRLVVDGSSHY
KNEPSLNDIIEQGPVILPDIVDMLLRFRSGKTAITSDVAKAFLQVFLHEEDRDLTRILWV
KDFRKAVTEDNIQVFRFTRVLFGLNVSPYLLAATINHHLSQLPDKKLSKEVINNIYVDNV
IITTDGSTEEAVQIYKKLKTTFTDMNMNLREFWSNSQEFNSQLEEADKAKDENFKVLGIK
WTTHTDILTMSAGIEKIDNNSRRTVSSAIAGIYDPNGFLAPLILPAKLFQRELWIDTYGW
DTKISKIHNESWLNIAEQIDGFTRDMPRHVIQKNKPNTLITFADASKDATATCIYVKNEI
GVHLIFAKSKVKPIKEKWTIPKLETQALKMATEKTVQVWKALTQGDMTVDKVYIMTDSTI
TLDWLKANPGKKETGIFVTNRMNAVRQLTSQIEDGGTEVKFGHVTTDQNPADLGTRGLEK
NNFATSIWWNGPKVLEEKEWTNKFKFFSLKSRDDFNTFAVVKREEEATQVFNCAATKSFE
VMKRIAAQAMKFIKITSERLPEERKKKMSEKIPFLQLENSPGRINSAQIKEAEVVLIKDH
QRSFTRKFLNRCKDLGLVEDPRGVIVCKGRMELAELNKDSREPILIHEESDLAAQIIRNA
HGKFHVALDHTMDKVRRRFWMLKLRQKAKTILSRCSECQRFNKQPCRYPDMARMPKSRLK
PTKPFDCTGLDNFGPITIKKEDGTEDSVYGTIFTCAVTRLVHVEVVSDMSTQQFIQAFRR
FVAIRGMPKKIVSDNGTNFVLGKKIIEEAMTNDPLCQSIEWKMITPYSPWKGGFYERMVK
SVKHAFMKNQRRNKLSLEEIQTVFYEVTATINSRPLTYLEEDVNNQSPIRPIDFVYSAMD
TTFPLQQVMESTEDYLPPAEMRSKETKLGTIEALKSSIKRTDAIWNTFNTTYLSELREHH
RSRMNNKRGSPKLPKEGQVVLLCDENQPRNEWKRGRVVKINKSDDGIVRDVEVRNHQGNQ
LNRSINQIIPLELDSSSDEEEESKKQPQKEESTAQKTEDNSKKYNLRERKPVNYNEERTT
FSITSIPYALMMITIMSLWTGAAAEPIRVECNSQGLQIQGQYEKFEACSQDYCTSSTRIG
WSSSQNIWLPPKIKIHPHKVTMKIHDGKQLKITEMECPSIPLCSTIDCTVCWSNILNPEC
HITWAILGFAAILFAVLMCIHATCCVPVKMADVFKLGCRILTAISMILAIIFNWCKKTWR
TRKPRKAQWRELIVTIILLILLQQVSKVSSCQELDVVNQQETICDTDGKCITVTEEIMRL
NNFHKEGCLRLEKNGTTIRDIRVEMLEIELHCIKKSIAFTQNVETRVWSTKRCPRMGSCI
NDKCMNVTKDTVLPELKEVNQYVGNVGCAESCGGPGCGCFFVSSGCIFYKTYAIPKSPEA
IEIFTCTDFEPAAKIKVTITGMNSCKNRAEVIEMVAPLGKTIPMKEISVTVDSIEVPPLP
SLNSWFIRNHTTMATWDEHKLPFYHCDEKLKNCKLEEQCQCNAAEDQMRCTCQDMDIFNH
FQQPERRLPVQIGHLKFKEYKEKVKGSITNGCTTTLTVKINDLWKTTIVKSKETCSIENS
IANGCYSCERGAVAEVKCFSSTEETIGNVDCGNEQFAVQCSPQGSDNNITFFADKARIHR
QCTVDCGGKKKENFEVSGVLKYSGSIWTSIHHLLNGNTTIYNEINLPDLHHIWESYMTYM
KTIFIVIIIVGVIFLMTYSIITRSGLAIVKGILRITITIVIMPIKMIRMIRRKKRHAHLH
TLICMLLTIPTVFNFPILSNSSFSSAHFSNFRTIPNHTKFPNTSQLNPQFSIPFNPQFST
QLFPQSSSQTSNFVLSSNAPKLTDIKVQIAEMEETLRQVQTMVAHIQSLIMHTDTTMMAL
ERKIGEDFKKLNERLDKMEEYLKTTDQDVAVMAREMAKQAQDQAAVLVVGPPALSDEMIR
REPEREVIVQMEEEEMEEQFLLDKEEEEMEEQFLLDKEEEEIQLEDDEELVQSGPLHRHQ
ENKKDSHGSLKGYKIPKKKMEPQEEEDEEEEEPKKLKSQVARALKTRILKKNPPKFNQGC
AFCEEKHMSDRCFNFPEYPERKKKLMKKQLCLKCLRRHQDGEKCKSQKECHYCQQLTHHS
SMCPEKLEIKWDENDGPSKGAKKRKCEDEPHKSKKSKE
Download sequence
Identical sequences E3N204
CRE17428 XP_003097517.1.11157 31234.CRE17428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]