SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE17855 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  31234.CRE17855
Domain Number - Region: 240-274
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000272
Family Retrovirus zinc finger-like domains 0.0064
Further Details:      
 
Domain Number - Region: 300-386
Classification Level Classification E-value
Superfamily Acid proteases 0.0013
Family Retroviral protease (retropepsin) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE17855
Sequence length 673
Comment (Caenorhabditis remanei)
Sequence
MSFSTERIKERSSSVTSSEKSWAVQMNEVRLKERRKLVKGFTDFLESSGSMESDMYEALK
AVCKGNERQSEVLVEPVKKYCHELRERFEELGGERWPLEIIGVMRENGVETVEELRELCE
KGVEMVPGGIVENANKAQDELALLQDAWNKERETLFREVNKLKEEKRLAEEAVSKYKKTL
KEEREASSELRGLLRKQENEPKKAGQARDTKEVPVPSRLEVVRKWSPRDSDDEFSMHGRR
GDRKTVGERRDSGAKMKCFTCGGIGHGSWQCVSKRVDKVQIQEGTVENAGVETVEMVEML
GQRRRVVIDSGAVVSVISTTAYERLKAGCRDWEKEVEVFGKPTFTVLNASNSKMRVRGQI
KIPMVVRGRKRILIGTNAFESIGVELKWKDPYGLVNAEENSAEVQFIGGEKKLERPGEKL
RKVPTEVSGIQCKSVAVRGERGRRASTGDVGEVFKSEGEEKERKKVKIRASVAVIGPRLE
ARGPGVLEYRNKTITGWTQKFDWGAVKEAVVLVEYTDKEDENSKRVEFVKSVAKEVEKVW
MMPRSLQCELGDVGNVAKQWKEWLKTSANVEVVDPLMPVGNHKTPLILEKWHRKSLDGLQ
KYLHNALPSHSVRCKWEKNTDRRPQSGLKKDLGKGCPIAERRGKWLRRSSTFSKPHGITE
VKGNEYSRGNRKT
Download sequence
Identical sequences E3MDP7
31234.CRE17855 CRE17855 XP_003105672.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]