SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE18153 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE18153
Domain Number 1 Region: 543-642
Classification Level Classification E-value
Superfamily Acid proteases 0.0000704
Family Retroviral protease (retropepsin) 0.02
Further Details:      
 
Weak hits

Sequence:  31234.CRE18153
Domain Number - Region: 488-517
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000565
Family Retrovirus zinc finger-like domains 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE18153
Sequence length 858
Comment (Caenorhabditis remanei)
Sequence
MSFSVERTKKGSSSVTSSEKSWAVQMNEVRLKERRKLVKGFTDFLESSGRMESDMYEALK
AACKGNERQSEVLVEPVKKYCHELRERFEELGGERWPLEVIGVMRENGVETVEELRELCE
KGVEMVPRGVVENAKKARDELALLQGAWNEERETLFRELNKLKEEKRLAEEAVSKYKKTL
KEEREASSELRGLLRKQESEPKKAGQVRDTKEVPVPSRLEVVRKWSPRDSDDEFSMHGRR
GEFSDSERSWGEDWKSGRSSRYSAENEVMMGMVASMGRMMKASALPEPKTFDGTGDFKEF
KRAFLLKYQQVTDEDDELVAILEERFLKGAAKSLFKSLGDRQERPIAELFVEFERKLRKR
QGDAKAEALHEFDRLQKAPGQKLWEYLVEVEKWSKKAYPEVEKATLSQMRTTKLMRATED
DDMLQSVLVAKRLELPLAAQYDQLKDIVLQRENEKLRKQKERMGRLGDQGNSDGRRSPEG
SIDGDRKTVGERRDSGAKMKCFTCGGIGHGSWQCVSKRVDKVQIREGTVKNAGVETVEMV
EMLGQRRRVVIDSGAVVSVISTTAYERLKAGCRGWEKEVEVFGKPTFTILNASNSKMRVR
GQIKIPMVVRGRKVRVVFQLVENWVEKILIGTNAFESIGVELKWKDPYGLVNAEENSAEV
QFIGGEKKLERPGEKLRKVPTEVSEIQCKSVAVRGERGRSASTGDVGEVFKSEGEKERKK
VKIRASVAVIGPRLEARGPGVLEYRNKTITGWTQKFDWGEVNEAVVRMRTSRIYLRMALP
NNSTGCQLKKDETIGQDTTIWIGESLRKRTPDRREEGEVASPRFFSHETHWKRRNQRREG
TWNPDDPSHVKRSNMNSS
Download sequence
Identical sequences E3N8I7
CRE18153 31234.CRE18153 XP_003095265.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]