SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE18183 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE18183
Domain Number 1 Region: 9-135
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000000431
Family C-type lectin domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE18183
Sequence length 137
Comment (Caenorhabditis remanei)
Sequence
MKPFEPPKWVNITEAKGFCENMGYKVTGVATVEESKWIWKKVKVLLPGKRYHSFYIDGVR
TKNCSLTRCNKFEFSDGYTVIDDAVLSSTNADLSISYNGIPENCLGVVDMGTAQTINDVR
CDSTNKNVGVVCGYKLY
Download sequence
Identical sequences E3N8L1
31234.CRE18183 CRE18183 XP_003095285.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]