SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE18229 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE18229
Domain Number 1 Region: 804-928
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.00000000000145
Family Reverse transcriptase 0.0098
Further Details:      
 
Domain Number 2 Region: 438-477
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000698
Family Retrovirus zinc finger-like domains 0.0024
Further Details:      
 
Weak hits

Sequence:  31234.CRE18229
Domain Number - Region: 390-427
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000377
Family Retrovirus zinc finger-like domains 0.0048
Further Details:      
 
Domain Number - Region: 555-601
Classification Level Classification E-value
Superfamily Acid proteases 0.0337
Family Retroviral protease (retropepsin) 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE18229
Sequence length 971
Comment (Caenorhabditis remanei)
Sequence
MVHRNRVEQSGRIRVANQANQDYLQSHAIYFYLPTLLFYSSLLFYEMSVLRYVQGVVTKS
CGTLKTYIEECEVNLVDWGHLDSNDEAIRTEIAKTIHILEAKISTVNVAMNNFLIKAAEI
DEKNSAEQEKVVEKINQVIEITDIANSVMARAQAELKRMSQPAEKKEEKKMGETIFAHRN
NQMATTMPKVPKFNGNRSDYENFWLLFETSLKVNGVENDLLKFNFLLNSLEGEPKELMRQ
FRLSEENYQKAVNLLQKKYYDKKRIVTELTRQLRSIRAKSESTSDQRKLLDTITIIVSQL
NENRGQIDAEMTKDIIVEKFDMRIREKIEDMQLDAQNDWTIEELLEKMDSVITREEKLNI
KLDRSEKSEKSSKETSKVRTSNNYSTNNSNNGKSKSRENGRDTDRPKTCVYCKADGHWGF
ECVKVSTAKERKDILKSEERCMQCTVKGHNMDNCRRKRKCYHCKEIGHHSSICTNKPKDS
SDDSSSRRRETADKNKQKTKTTAVAQIEEDETTSERKEEELNSHVSKVEKKAKTRAFIPT
LRTRAYNPQNGQWDEVSMMLDCGADQTYVTASLAKKWNLPMYDKEQFWLRTFDSEEAALK
TYGRTNIKILAGAKTMEMDVLISANLAGKVKKARLTEEDWMYVNEKQLQINEDCKEDISF
PDVILGCDYLGDIETGRRIRLPSGLDVIGTLMGYTTTGKMTHSAQEKEDKEEKFIMVAIE
DSEKTGQDIEESQKRDTAMKTQEEFTGSAQEEKARIDKEVWEFFKRTVVKKNGRYYARIP
FKKGHPVLPDNFSIALKRLLSVHRNSSKEVLKMIDDVFKDQLQKGIIEEVDPKKHTQFLV
HYNPHQPVITPQKTTTKCRVVIDGGSHYKGKPSLNDVIHQGPVILPDLVDMLIRFRAGKY
AMISDVEKAFLQVFLSEQDREVTRVLWIRDLEKPLTEENIVTYHFTRGVSVKLDGIQREE
LMRRTELKKNT
Download sequence
Identical sequences E3NFH0
CRE18229 31234.CRE18229 XP_003092850.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]