SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE18334 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE18334
Domain Number 1 Region: 12-52
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000593
Family Retrovirus zinc finger-like domains 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE18334
Sequence length 170
Comment (Caenorhabditis remanei)
Sequence
MSESEKNSKIVERKGCFRCGGRHVPERCWTEKKECYQCGKRGHIAKRCQSEKMFWNGGNE
KMRGRLNHEEKEKFGRREANGENFHGVCPLKVNIPGSAWNNRSAAGNRSWRDTGYGVGRM
RPRGPSMRNNYWLPSHDNDGWFYMSGRKLRWILEEKSNRANFSYCGGGVV
Download sequence
Identical sequences E3NQY1
CRE18334 XP_003089191.1.11157 31234.CRE18334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]