SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE18666 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE18666
Domain Number 1 Region: 543-642
Classification Level Classification E-value
Superfamily Acid proteases 0.0000296
Family Retroviral protease (retropepsin) 0.017
Further Details:      
 
Weak hits

Sequence:  31234.CRE18666
Domain Number - Region: 483-517
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000419
Family Retrovirus zinc finger-like domains 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE18666
Sequence length 939
Comment (Caenorhabditis remanei)
Sequence
MSFSTERTKKRSSSVTSSEKSWAVQMNEVRLKERRKLVKGFTDLLESSGRMESDMYEALK
ATCKGNERQSEVLVEPVKKYCHELRERFEELGGERWPLEIIGVMRENGVETVEELRELCE
KGVEMVPGGIVENAKKAQDELALLQDAWNEERETLFRELNKLKEEKRLAEEAVSKYKKTL
KEEREASSELRGLLRKQESEPKKAGQARDTKEVPVPSRLEVVRKWSSRDSDDEFSMHGRR
GEYSDSERSWGEDWKSGRSSRYSAGNEVMMGMVASMGRMMKASALPEPKTFDGTGDFKEF
KRAFLLKYQQVTDEDYELVAILEERYLKGAAKSLFKSLGDRQERPIAELFVEFERKLRKR
QGDAKAEALHEFDRLQRAPGQKFWEYLVEVEKWSKKAYPEVEKATLSQMRTTKLMRATED
DDMLQSVLVAKRLELPLAAQYDQLKDIVLQRENEKLRKQKEKMGRLGDQGNSVGRRSPEG
SNDGDRKTVGERRDSGAKMKCFTCGGIGHGSWQCVSKRVDKVQIQEGTVENAGVETVEMV
EMLGQRRRVVIDSGAVVSVISTTAYERLKAGCRDWEKEVEVFGKPTFTVLNASNSKMRVR
GQIKIPMVVRGRKVRVVFQLVDNWVERILIGTNAFESIGVELKWKDPYGLVNAEENSAEV
QFIGGEKKLERPGEKLRKVPTEVSEIQCKSVAVRGERGRRASPGDVGEVFKSEGEEKERK
KVKIRASVAVIGPRLEARGPGVLEYRNKTITGWTQKFDWGEVKEAVVLVEYTDKEDKNSK
RVEFVKSVAKEVEKVWMMPRSLQCELGDVDKVAKQWKEWLKTSANVEVVDPLMPIGNHKT
PLILEKWHRKSLDGLQKYLHNALPSHSVRCQWEKNADRRPQLKKDLGKGCPIAERRGKWL
RRSSTFSKPSGREETKGEKARGTWTTQATSKADVKLNFP
Download sequence
Identical sequences E3LKW2
CRE18666 31234.CRE18666 XP_003115243.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]