SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE18966 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  31234.CRE18966
Domain Number - Region: 108-125
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0628
Family Retrovirus zinc finger-like domains 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE18966
Sequence length 142
Comment (Caenorhabditis remanei)
Sequence
MAREQFEEVESNMRARGTNSHSKESKKFSPQMMTDLVEKLNQVSEKLDKLDNTIQHFRPM
KHKLGAHPEAPPTKREAICVFCSGNHQATHCTDYASSDARWARTGVLSICKHCGRRGHQP
ESCYKRGRKCNHTETKKYFLKY
Download sequence
Identical sequences E3LKL0
XP_003115650.1.11157 31234.CRE18966 CRE18966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]