SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE19006 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE19006
Domain Number 1 Region: 463-563
Classification Level Classification E-value
Superfamily Acid proteases 0.00000493
Family Retroviral protease (retropepsin) 0.024
Further Details:      
 
Domain Number 2 Region: 415-440
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000436
Family Retrovirus zinc finger-like domains 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE19006
Sequence length 756
Comment (Caenorhabditis remanei)
Sequence
MSDKTSSKQSTSKVDDNRMIVVETQMSVRERRKKVKKFTKLIASSVKVEDETRLQLGELT
AKCSEEEADAILEPMRSFHRELLEKFEEIGGDEWPRSVIRVMREFKLESVEELREAAGMR
KREMLGEQIRKIQREKEVAEAQVSRLEKALKQLRKTQELEERKPKGLWDEAQGSKSWYER
VENWDFERSRKRGGEDAFSRKTSSQSGSSQVNDMVQCMNRMLKSSALPEPKTFDGTSEFK
KFKRAFLLKYNHVTESDDELVAILEEKFERSIQSLFEEFEQKLRKRQGDSKIEALNEFEG
LEKRSNQKMWEYLVEVEKWSRKAFPEVKQETLSQMRTTKLMKAVRGDETLHKMLIMKRFE
LSLEEQYDHLKDIVLQQENEQRRGNSQKSGNSEGWKERQKAENDGEKDVAEKESGENRYW
REQKCFSCGGVGHLARQCSPKPVQSVEVRGKGEGVGIVAVETVMMLGQERKMVIDSGAAV
SVMSTGAWNGLKKGCRNWMEVVKRLGKPSFEVIDTSKKKMRIIQQIEVPIQVRDRKAEVV
FQIVENDAEIMLLGTNAFESIGVSVEWKQERTNGQQKKGKRDATSSEEKKVFMVGNLGIR
MEEKKEGMKPNKTVIRESKILITPRINVKGKSIFEYRKKSIVFLLELTEDEETNQKLGDL
VRKLAEEVKEITIIPYKMDCAKSGLVESWKRSWITAGNVEWIDSSASGKTVEKLKTWEQL
LEFLEARTTENVVVAQLRKESVTLEPRTKENKWSHQ
Download sequence
Identical sequences E3LL23
XP_003115632.1.11157 31234.CRE19006 CRE19006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]