SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE19532 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE19532
Domain Number 1 Region: 464-899
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.22e-120
Family Reverse transcriptase 0.0000863
Further Details:      
 
Domain Number 2 Region: 1079-1235
Classification Level Classification E-value
Superfamily Ribonuclease H-like 4.05e-40
Family Retroviral integrase, catalytic domain 0.0085
Further Details:      
 
Domain Number 3 Region: 331-424
Classification Level Classification E-value
Superfamily Acid proteases 1.72e-16
Family Retroviral protease (retropepsin) 0.0085
Further Details:      
 
Domain Number 4 Region: 264-308
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000209
Family Retrovirus zinc finger-like domains 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE19532
Sequence length 1398
Comment (Caenorhabditis remanei)
Sequence
MADSPTQHGDQDTQAAILKLTEQVMNLMTIFTQNQTPPAAASSTTVTSTFDSSKLMDTIS
SRIPMFTYVPEEEKTFEVWFSRYEEIVTKDGAQLADDTKTRVILAKLSPTDYAHYTNRIL
PKVPNELSFNETIGLLKTTFKSTTSVFRKRQEFLRSEYSGGSLEEYTGSILRGYTSSEFK
KMSDDQLCCLIWINGMKDSSYQDIRTRALQVLEQKPRITLLEMEAEVKRVLDIRADSKAV
APSNQSPEVQAVQKKPQNQHNQNKTEKQPPSPCYRCGGNHWSKDCKYQTATCRTCNKTGH
IAKSCRSKPRDHPKVSHKVKTVFVGVAATHGSTRIYKSVTINGKPIKMLLDTGADVTLVN
LTDWKRLGRPKLEPPSIRVRAANNQVITVKGSFNCNFELNGVRATGTAHVTETNTLLGID
WVAQDQTFWKLLHDAPTINSASTSSGSACSYLDGLRDGLKVDLSSEYPDVFQSGLGLCTK
MRAKLKLKPNAQPVFRKSRPVPYASLEALSNEIDRLEATGVLKSLDHSDWAAPVVAVTKK
NGSIRLCSDFSTGLNDAIEAHQHPLPTADDIFAKLNGGKFFSQIDLADAYLQIEVDDDSK
KLLVINTHKGLLHYNRLPFGVKAAPGIFQQVMDTMLAGLDGVSCYLDDIIVTGCSIEEHN
QRVKKVIERIASFGFRMRLEKCSFLMPEIQFLGFVINEQGRKPDPQKIADIKAMPAPKNA
IEVRSFLGLIQFYGTFVRDLHRLRPPLDKLTNKDVEFKWNTECQHAFDQVKEMLQSDLLL
THYNPKLPIIVAADASQYGIGATISHRFPDGKEKAIYHVSKALNKAQRNYSQIEKEAFGL
VTAVTKFHKFVHGRRFTLRTDHKPLLSIFGEKKGVPIYTANRLQRWATILMNYNFSIEYI
NTKNFGQVDALSRLISDQMQQREETEEVVIAHIEGDIICSLDRVCDQLPVTVDIIRSETH
RDKLLMKVMECIRSGKWPVLDKAAPIWLFQQRQTELSIVQECVMIGERIVLPTSLKTKVL
IMLHRGHPGIVRMKKLARSYVYWPAMDKDIENLVKCCDPCAGAAKNPVKNVLHSWPCSTK
PWNRVHADYCGPLQGIYYLVIVDSYSKWPEVYATKSITTSATIHIFRQVFAQFGNPEILV
TDNGSQFSSKQLEQFCKRNGITHVRSPPFHPQSNGQAERFVDTLKRALQKLRGEGNSDAA
VTTFLQTYRATPCAASPNGLSPAENFLNRKLRTELDLLLPMDPNVGDRNRKMEEQFNNQH
GARPRHFVVNQKVYVKDYRSPKATWIPGIIIRKLGGTIYDVRADDKTWRRHANQLRTRSS
ATACQEAADLLEMPIRFTQEPITEPVTPPSSTTPPLPTNPIVPSQPTSPSPPPLRRSSRN
VHPPKRLCMDPKKKSYRR
Download sequence
Identical sequences E3NJ82
XP_003091538.1.11157 CRE19532 31234.CRE19532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]