SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE19811 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE19811
Domain Number 1 Region: 546-572
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000108
Family Retrovirus zinc finger-like domains 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE19811
Sequence length 1001
Comment (Caenorhabditis remanei)
Sequence
MNVKMNETVLSCRMNGEKKSTAAPTSLEEPTATSVFSGQSIQGNQERTKMVSLLEANEIH
TEEELNKLFEKYEQLEYELSVKVEYLQRSQRQTDSFRSELCRLKVKCDQQQQKLLAEEEK
AKKMSEELKTKYSNLRANSSTRVGECNQQTGERKESTRYYNAETSEIIETIPLQESLDSG
RNWNQRIVEQNAQRNIIVHNEHEMSNRNAQWRMAQALPDPPVFSAGKNSVNAETFERAFY
MKYRFFDIEAQKNFLETRFLSGNALAVYKGLPESDKNSVSRILDAIKRRLSQSEPEESRR
AKSKFQALKLHKEQTVQDFCLIMDEIVRIGYKGVPEYQISSMKTTKLLDEMREHTVFEVL
LQILGSQLRNCPVEEQYELCRVEATMFDEEWRSGKKKAAKNEMRMNRGQSDQYSHNLQRT
GSTQNNAFVPQQSSRFNRYTPNRQSNSYQTNSGSDSNSNQCTSTTGQQQNSSLRNDLNDQ
CAPKGYMYNEKSPECWKNLVHSSDSADNASNSALRFHKCSECNQTGCHAPTCSRAPGSNT
SKVKINSTIVCFRCDQQGHIASKCPTRNASIQEVRMAPDVQSKVEDQKCKMKFDTKCSSD
KESERKLIDHEMETKDLYEGQSVAASVFKKDMVIDVDRVPIKSINSIEFSVMSSDEMLRS
GDTKDDGLQTSWTKHAHTKDNSGGVNREFTEANSQKNGYCDEEHKSERDQRLCSISLTKT
KKQSVQQKKVSDVISSFGDLKRDQKEHNVQKNIVNYESTQSYMSSEDGDGKKKRNTVDQK
AVDNVMCQGPPLNFIENSSSLNQYDNVDANEATDIVKINTSKSKFLNQKCPKKPGLQKTG
DDTCGVNFPKKSKRRNKEETSPRTDPPVILRFDSDLWLHDTSPGSLDSDNDDQLDSYQKW
KRAVPKMFKSQVVPRPLKDPPTSTNQSTWSDIKFESAKESPRPLNDPPDSWMEDVNWRRM
QEEYRPRKDPPSPYCQHGHRNLLGCLQSTQFLPTPMSTVSS
Download sequence
Identical sequences E3MTF1
31234.CRE19811 CRE19811 XP_003100586.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]