SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE19883 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE19883
Domain Number 1 Region: 356-450
Classification Level Classification E-value
Superfamily Acid proteases 5.63e-16
Family Retroviral protease (retropepsin) 0.017
Further Details:      
 
Domain Number 2 Region: 282-321
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000082
Family Retrovirus zinc finger-like domains 0.0055
Further Details:      
 
Weak hits

Sequence:  31234.CRE19883
Domain Number - Region: 503-542
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000107
Family Retrovirus zinc finger-like domains 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE19883
Sequence length 661
Comment (Caenorhabditis remanei)
Sequence
MGKPSGGKEVKTEDVLGGIMQQLTLLNERSEQLMEENRELRAEQRAVAGRSSEKSNARLM
AELSKRIPKFSYSLSEPDSFKRWIARNELIFTEDGADLTERERTRLLIGCLEEATYQRYI
DAQRDETDVFDIGYENTVKALHKVFGGHRSMMIRRQKCLEISRSSGMYGDPLEYTNSVGE
AVMEAKLSSMTSDDWSIFLFLRGLDMPGDAKAKVWLMQFVEQSEKSGQKLKLADVHDEWC
RYMQLKVQTEVVSSTAANPHEEVNVYGIENRDDRRSEHRTSSYRGGFRGRREHFGNRVLT
CYACGEPGHFSYECPKRKSERNRSDSRNVNKNEPESRKVNTITIQTIQVDGVTTESQARP
RMMVKVEDKMLEFHLDTGSQITLISEKSWKELGSPSLSEVPFKVACANRTELVVKGRVSV
KFELKGVTYSDYVYVTNRDMNLIGMSWLCKSPEIEAVLKDMVANSKIEEVEEGDQTSWTS
QSGERVNQVREVSESEKNSKIVERKGCFRCGGRHVPERCWAEKKECYQCGEKGHIAKICQ
SEKMFWNGANKRMRGRLSHEDKEKFGRREANGENFHGVCPLKVNIPGSAWNNRSAAGNRS
WRDTGYGVGRMRPRGPSMRNNYWLPSHDNDGWFYMSGRKLRWILEEKSNRANFSYCGGGV
V
Download sequence
Identical sequences E3N2Y0
XP_003097211.1.11157 CRE19883 31234.CRE19883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]