SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE19985 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE19985
Domain Number 1 Region: 300-399
Classification Level Classification E-value
Superfamily Acid proteases 0.0000413
Family Retroviral protease (retropepsin) 0.017
Further Details:      
 
Weak hits

Sequence:  31234.CRE19985
Domain Number - Region: 240-274
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000272
Family Retrovirus zinc finger-like domains 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE19985
Sequence length 670
Comment (Caenorhabditis remanei)
Sequence
MSFSTERTKKRSSSVTSSEKSWAVHMNEVRLKERRKLVKGFTDFLESSGRMESDMYEALK
AACKGNERQSEVLVEPVKKYCQELQERFEELGGERWPLEIIGVMRENGVETVEELRELCE
KGVEMVPGGIVENANKAQDELALLQDAWKEERETLFRELNKLKEEKRLAEEAVSKYKKTL
KEEREASSELRGLLRKQENEPKKAGQARDTKEVPVPSRLEVVRKWSPRDSDDEFSMHGRR
GDRKTVGERRDSGAKMKCFTCGGIGHGSWQCVSKRVDKVQIQEGTVKNAGVETVEMVEML
GQRRRVVIDSGAVVSVISTSAYERLKAGCRDWEKEVEGFGKPTFTVLNASNSKMRVRGQS
KIPMVVRGRKVRVVFQLVDNWVEKILIGTNAFGSIGVELKWKDPYGLVNAEENSAEVQFI
GGEKKLERPGEKLRKVPTEVSEIQCKSVAVRGERGRSASTGDVGEVFKSEGEKERKRVKI
RASVIGGEGPGVLEYRKKTMTGWTQKFDWGEVKEAVVLVEYTDKEDENSKRVEFVKSVAK
EVEKVWMMPRSLQCEFGDVHNVAKRWKEWLKTSANVEVVDPLMLRRKSQDTVDLGEMASE
VAGWSTEWEKNADRRPQFWIEERLWKRMPDRREEGEVASPKFYILETHWKRRNKRRKGTW
NLDDPSHVKG
Download sequence
Identical sequences E3NCD5
CRE19985 31234.CRE19985 XP_003093929.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]