SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE20003 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE20003
Domain Number 1 Region: 516-616
Classification Level Classification E-value
Superfamily Acid proteases 0.0000155
Family Retroviral protease (retropepsin) 0.023
Further Details:      
 
Weak hits

Sequence:  31234.CRE20003
Domain Number - Region: 468-493
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00138
Family Retrovirus zinc finger-like domains 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE20003
Sequence length 844
Comment (Caenorhabditis remanei)
Sequence
MSDKTSSKQSTSKVDDDRMIVVETQMSVKERRKKVKKFTKLIASSVKVEDETKLQLGELA
TKCSEQEADAILEPMRIFHRELLEKFEEIGGDEWPRSVFRVMREFKLESVEEWREACAKA
AESEEAEWSVGKVNLELQKVQYEKNLLTECWNEEKEMLGEQIRKIQREKEVAEAQVSRLE
KALKQLRNTLERQERKPNGLWDEVQGSRSWCERVETWDIERNDERSRKKGGEDAFSRKTL
SHSGSSEVNDMMQCMNRMLKSSALPEPKTFDGTGEFKEFKRAFLLKYNHVTENDYELVAI
LEEKFLKGAAKSLFKTLPKRFERSIQSLFEEFEQKLRKRQGDSKIEALNEFEGLEKRSDQ
KMWEYLVEVEKWSRKAFPEVKQETLSQMRTTKLMKAVRGDETLHKMLIMKRFELSLEEQY
DHLKDIVLQQENEQRRGNCQKSGYSEGWKERQKAENDGEKDVAEKESGENRYWREQKCFS
CAGVGHLAHQCSPKPVQSVEVRGKGEGVGIVAVETVMMLGQDRKVVIDSGAAVSVMSTGA
WNGLKKGCRNWMEVVKRLGKPSFEVIDTSKKKMRIIQQIEVPIQVRDRKAEVVFQLVEND
AEIMLLGTNAFESIGVSVEWKQERTDVQQKKGKRDATSSEEKKVFMVGNLGIRVENTKPS
GKTAERSKEIAVDTVTEEKKEGMKPKKTVIRESKILITPRIGVKGKSIFEYRKSALNTWK
DKFDFANVESIVFLLELTEDEETNQKLGDLVRKLAEEVKEITIIPYKMNGAKSGLVESWK
RSWITAGRVKWTDSAASADEKFKTWEQLLEFLEARTTENVVVAQLIKESVTSEPRIKEDK
WSHQ
Download sequence
Identical sequences E3NCF8
XP_003093902.1.11157 CRE20003 31234.CRE20003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]