SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE20057 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE20057
Domain Number 1 Region: 283-322
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000192
Family Retrovirus zinc finger-like domains 0.0024
Further Details:      
 
Weak hits

Sequence:  31234.CRE20057
Domain Number - Region: 235-272
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000195
Family Retrovirus zinc finger-like domains 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE20057
Sequence length 372
Comment (Caenorhabditis remanei)
Sequence
MKRMSQKAEKKEEKKMGETIFAHRNNQMAATMPKVPKFNGNRSDYENFWLLFETSLKVNG
VENDLLKFNFLLNSLEGEPKELMRQFRLSEENYQKAVNLLQKKYYDKKRIVTELTRQLRS
IRAKSESTSDQRKLLDTITIIVSQLNENRGQIDAEMTKDIIVEKFDMRIREKIEDMQLDA
QDDWTIEQLLEKMDSVITREEKLNIKLDRSEKSEKSSKETSKVRTSNNYSTNNSNNGKSK
SRENGRDTDRPKTCVYCKADGHWGFECVKVSTAKERKDILKSEERCIQCTVKGHNMDNCR
RKRKCYHCKEIGHHSSICTNKPKDSSDDSSSRRRETADKNKQKTKTTAVAQIEEDETTSE
RKEEELNSHVSK
Download sequence
Identical sequences 31234.CRE20057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]