SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE20219 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  31234.CRE20219
Domain Number - Region: 189-214
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00418
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE20219
Sequence length 382
Comment (Caenorhabditis remanei)
Sequence
MTDPNTETINEDGQKLSEYGVLKDDKLPAMPVEGNTHEDPSADGKVIVSVKETEEAAKLR
ESQEEKILSIQKAYFLVAGKIDTLEKESEAHRDVLDQITTDQSNLSEKIDQQMSTKADLQ
CFQLGIEDEVSRLKEAVKELKHRLLGEPKESPLDCFSPSPFKIPKMSEKRGPTGEIEENS
SSITRKSLKDCPLCRDSGHRLADCPQFASKLEKLQQFRKRQICCTCGNLQCSRINCPKAT
IQCQICKGKQEFGKTLHISEICIFETHVSKRPSQTEYRRQKFSAQRPRSKSPAKENQAAT
QGPQPAQLQQQMVQQQYQQQPMMPTGPAFGPSYQMNPMIPPQQYQYQHPQQMVPMPLQPI
PIQQYGYYQQQPGPSNQTTHHQ
Download sequence
Identical sequences E3MCQ7
CRE20219 31234.CRE20219 XP_003106136.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]