SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE20249 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE20249
Domain Number 1 Region: 7-112
Classification Level Classification E-value
Superfamily GlnB-like 2.63e-28
Family Divalent ion tolerance proteins CutA (CutA1) 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE20249
Sequence length 116
Comment (Caenorhabditis remanei)
Sequence
MTTPAVKLILVYVTAPSRDVAINMARITVAESLVACANVIPGVTSVCTGYQWQGKIEEDQ
EHVVVMKTVDSKAEELSQRVRSLHPAVTPCFVTLPIEKATADFAEWIIKSTHSHSI
Download sequence
Identical sequences E3MCX1
XP_003106058.1.11157 31234.CRE20249 CRE20249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]