SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE20285 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE20285
Domain Number 1 Region: 141-240
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000000013
Family Voltage-gated potassium channels 0.0047
Further Details:      
 
Domain Number 2 Region: 41-89
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000000144
Family Voltage-gated potassium channels 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE20285
Sequence length 330
Comment (Caenorhabditis remanei)
Sequence
MNETPDVVEGDAVSKCLKIFPIDKKITIEMKRKAEKCIRNESVIDDFGKAFYFSWTLYST
VGYGNLYPHSSIGRFMTAFYSLLIIPVYIAFKFEFGTFLVHFWITAVKHTGNYFKILFNR
VMNRVFVRVPIDQENLKSLHHRDRFIFFSSIVLCLICLISSSILFSICENISFSSSIYFG
IISMSLIGLGDIVPTNLIWFIAYCFFFLITDILSNHFFYFCQARIRFFFHYFARRLLLKD
RRNLKSESTVSIKNVPVINSQCMPSLKSMASDKSKEKPVVHTPPTNSGPSGGELEKKKAP
KANEPQMAARDANDNETINDAKSDWGELPA
Download sequence
Identical sequences E3MCJ4
CRE20285 XP_003106042.1.11157 31234.CRE20285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]