SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE20460 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE20460
Domain Number 1 Region: 473-905
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 4e-116
Family Reverse transcriptase 0.0000531
Further Details:      
 
Domain Number 2 Region: 1082-1237
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.26e-41
Family Retroviral integrase, catalytic domain 0.0042
Further Details:      
 
Domain Number 3 Region: 352-442
Classification Level Classification E-value
Superfamily Acid proteases 0.000000000109
Family Retroviral protease (retropepsin) 0.016
Further Details:      
 
Domain Number 4 Region: 282-324
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000135
Family Retrovirus zinc finger-like domains 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE20460
Sequence length 1440
Comment (Caenorhabditis remanei)
Sequence
MSDAEMNRKFIEMMEFMQKQMAEQAKKHEETIAVLTKAVAEKSQIDGSLGTSSGLTVSQS
QLMNDIGGRISVFQFDLETEKTFSKWYARYSTAFTEEGKGLDDKNKVALLVSKLSEEVYE
QYSRRICPKLHHEVDFKDTVDILKEMFDIKKSLFSHRFACINIARDGDSPVEYTNKVNAL
CELAMLKDIDPDGWKVFFWLRGLDPAQDTKTRAYFLKYVEKKTELGEKVNINELCTEWQK
IQSQTSAVSEMEKSDTAVRAVYAKKPSNQKQNSSKNTAKHESSQGERCWNCGKGGHKKPE
CSQPLTKCFKCQKSGHLSTFCKAKKSSSYKKTQNVAIVGGASSEDAEVNSVRQYVSVDVN
SESVEFQLDTGSDITLIGREDWTRIGKPDLEKCTSKVKSASGNELKLLGRALVDFRLKGS
VGSGYVYVREHGNLLGLDWIGKSEEMSYHMGMMVNELTRSNTDSIHAELKEKFPEVFREG
LGRCVKEKAVLTVQENATPVFRPKRPVAYGATEVVEKELDRLENLGVLKKVNHSRWAAPL
VVVKKAGGDLRVCADFKTGLNTALEDEDHPIPAPEDVFATLNGGKLFSTVDLKDAYLQIE
LSDDSKALCTVNTHRGLYEYQRLPFGAKTAPMVFQRIMDKMITGLKGVTAYLDDIIIVGS
TEKEHTENLLELFKRISEYGFRVKLEKCKFLEEKIKFLGFIVDKDGRRPDEAKVAPIKGM
KEPVNQKELKSFMGMITYYSAFIPHMKSLRGPLDKLLIKDVEWKWSKLEAEAFQKLKDIL
SSDLNLTHFLPNVPIVVAADACDYGIGAVISHRFPDGTEKPISHAARSLNSAEKNYSQIE
KEGLGLIFAVKRFHKFLFGRKFLLRTDHKPLLSIFGSKKGIPVHSQNRLVRWSTILLAYD
FDIEYIKTDDFGQADALSRMIQKMPNEHEDVVIAQVEVDVEETLRSAIRKLPVRVRDIQE
ETKKSKMLQNVMKYVSRGIWPKKMDEKLKKFYSVKVSFSVVQDCLMMSDRVVVPESLQRA
VLKQLHEGHPGMVRMKQLARSFVYWPKIDEDVEKVVSACTICQVHGKTPKKVPLQPWKTP
ERVWQRVHIDYAGPENGQYYLVAVDAKSKWAEVMIVKSISAISTVRTLKDMFSQHGYPET
LVSDNGTQFVSKEFATMCQDAGIEHVRSPAFHPQSNGQAERFVDTLKRGLKKLKGEGSVN
NEILSQFLLHYRSTPSNALGGLTPAEVHLGRRLRTRLSLMMPQLNKTVDSEQRAMKEQFD
KHHGVKARSYRKGDSVFVKVFEKNTWSWKPGKVNQRQGRVVYVIGLKDGRERVVHANQMK
MRLEESTQEQSKEHEWATTMFDVFELPTVWSARKSTDEARRDNATSTPVMDSPQRVHQGQ
GTSASPAQQVQSRASTQQSSSQSTTTTAVQGQRLAPSPVQPRRTTRVRKNVVKYDPSDHS
Download sequence
Identical sequences E3N2U8
CRE20460 31234.CRE20460 XP_003097261.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]