SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE20843 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE20843
Domain Number 1 Region: 638-671
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000111
Family Retrovirus zinc finger-like domains 0.0046
Further Details:      
 
Weak hits

Sequence:  31234.CRE20843
Domain Number - Region: 173-228
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0384
Family Spectrin repeat 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE20843
Sequence length 698
Comment (Caenorhabditis remanei)
Sequence
MADIEEEEANRVAEEGRIRQEEANRLAEEERIRRENELLAEEPMDEGDEDKRVQEVRLAE
IEKVINETCIDIKNQTKFSTKQCRVLLSPLIGKILEVEEEFRGKKKESEFWENTNVKLNK
TVLSLQDELERKSPPQPPTPLEEPPTTSVLSGQSIQGNEERWKLVSLLEVNEIHNEEALN
ELFGKIEQLGNELSTHKELLQKAREQADRLREECFEAKQQIVLLQLKLKAEEEKSEKLKK
ENDTVAANNQSNNLTRYGEQRQSITEKNNNIVQTTGRHSMFATSTPQHGMHRQGEANGKV
GESRENARFYNADTSEIIDTITRQESRDSGGNWNQRIVEQDAQRSMIVHDGHEMPNMNMQ
WRMTQALPDPPVFSAGKNSVNAETFERAFYMKYRFFDIEAQKSFLETRFPAGNALTVYKG
LPESDKYSVSRILDAIKRRLSQSEPEESRRAKSKFQGLKLQKEQSIQSFCLQMDEIVRVG
YKGVPEHQISSMKTTKLLDEMKEHSIFDVSLQILGSQLRKCPEMEQYELCREEATRFDEE
WRSGKAKLNEKKVNRQQSNQNFSNQQSNYSNQNTSYSRNKQTVGNDETSQNWRERSQGKF
VPTNNAGGNNVVNKSVGFSECSECRLTGCHDPKCSRAPGSSTPRKSNPVVCFRCNEQGHI
APNCPQKSAQQTKQPRGYGKKCKTLDKKGVSWKCQKPE
Download sequence
Identical sequences E3MV35
XP_003099995.1.11157 CRE20843 31234.CRE20843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]