SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE21310 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE21310
Domain Number 1 Region: 449-787
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 6.58e-95
Family Reverse transcriptase 0.00029
Further Details:      
 
Domain Number 2 Region: 354-447
Classification Level Classification E-value
Superfamily Acid proteases 0.00000000000000493
Family Retroviral protease (retropepsin) 0.011
Further Details:      
 
Domain Number 3 Region: 288-327
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000331
Family Retrovirus zinc finger-like domains 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE21310
Sequence length 1062
Comment (Caenorhabditis remanei)
Sequence
MTMAKELTETLRAFREQIEASTEVNRRKLEENKWLRESLVRATGGSEANLGGDANTAPPS
RSGYSARLMGDLARRIPKFQFILDDPDAFRKWITRNELTITEDGKDLTEREKVRLLLGAL
EESTFHRYVDSQRDAGDIYEIAFKDTVASLNKVFGSHRSMMIRRQECLQISRSSGLFHDP
LEYSNKISEAVLDSKLSVMTSDDWSVFVFLRGLDSPGDAAAKAYLMQWAEQSERKKETVT
LAAIHDEWIRFIQLKQQTKTVAASSPKQQVGVNKVEKKNFRGDNKNKTETTANKSDSHSN
KEVTCFKCGERGHTAPQCPQNSGKKKGRYWVKKGVQKTQCVRVDGLHENQNNVSKPTMRV
NVDGQLLSFQVDTGIEITLINEQSWKDIGCPELEKVPHRISCANGTQMSVKGRALVSFEL
KGIQYTDYVYVKAKDDNLIGMSWISSLRDEHHPLPTSEHIFGKLKGSIFSQIDLRDAYLQ
LELDEEAQKLAVINTHLGLFKYRRMPFGLKPAPAVFQKVIDKLIAGIPGVAAYLDDVIVA
TDTMQEQEKILKKLFARFQEYGFKVSLVKCTFAKSEIKFLGFIVNGEGRKPDPEKTEVIR
KMDSPKNQKQLASFLGAICFYSRFVPKLSELRGPLDRLMKQDVKWKWTPIEQNAFDKLKN
AVADSTMLSHFKEDWKIIVAADANQYGIGGVLMHETPDGKEVPIAHFARSLTDTEKRYSQ
IEKEALALVYTVKKSHKFVFGRKFSLQTDHKPLSAIFGDSRDLPVHSQNRLVRWATTLLA
YNFDISYISTAKFSKADWLSRMIQNYPRDEDDVVIDLYNYGFDWSEIQRGNKSSWEFGVV
RRRFGNVLYEVQIGERFHRCHANQLRLRFGDRSKEDMFEETVFPMFFETVKGDGVQTQLS
GGPRVHGEGLNSLQFSDTSRSVDISSDFRDSFVGEEGVGRRESGKSARPPVELNFADDYD
SMSDRRRAPEFTTTINRSPHSDTNTNPSHSLRRSQRTKRAPTRFDPCPATSQGRGKPRGS
NRQDRPAGRGRGVAPASNRSVPLNSSLKGEGVGKERGRPRWH
Download sequence
Identical sequences E3MUM1
CRE21310 XP_003100089.1.11157 31234.CRE21310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]