SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE21526 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE21526
Domain Number 1 Region: 655-681
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000855
Family Retrovirus zinc finger-like domains 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE21526
Sequence length 1110
Comment (Caenorhabditis remanei)
Sequence
MSEGDEEEANRLAEEERIRRENELLADEPMEEGDEEKRFQEVRLAEIEKVINETCIDIKN
QTKFSTKQCRVLLSPLIGKILEVEEQFRGKKKESEFWENTNVKLNKTVLSLQNELERKSP
PQPPTPLEEPPTTSVLSGQSIQGNEERWKLVSLLEANEIHTEEELNKLFEKYEQLEYELS
VKVEYLQRSQRQTDLFRSELCRVKVKCEQQQQKLLAEEEKVKKMSEELKVKHSTHNANSA
TRFGECNQQTGERKESTRYYNAETSEIIDTIPLQESLDSGRNWNQRIVEQNAQRNIIVHS
EKGMSNMNAQWRMAQALPDPPVFSAGKNSVNAETFERAFYMKYRFFDIEAQKNFLETRFL
AGNALTVYKGLPESDKNSVSRILDAIKRRLSQSEPEESRRAKSKFQALKLHKEQTVQDFC
LIMDEVVRIGYKGVPEYQISSMKTTKLLDEMREHTVFEVLLQILGSQLRNCPVEEQYELC
RVEATMFDEEWRSGKRKAAQNEMRTNRGQSDQYSNNVPRTGFTQNNASVSQQSSRVNRYT
PNRQSNSYQTNSGTDSNSNQCTSTTSQQQNFSTSTDLTNQYAQKTDQQNQEPKGYVYNEK
SPECWKNLVHSSDFANNASSSALGFHKCSECSLTGCHAPTCSRAPGSNTSKVKINTTIVC
FRCDQQGHIASKCPTRNAVIQEVRVAPEMQSTVEDQKFKMKSDTKCSSDKESERELIDHK
METKDLCEGQSVAASVFKKDMVIDVDRVPIKSINSIEFSVMSSDEMLRSGDTKDDGLQTS
CTKHAHTKDSSGGVNREFTEANSQKNGNCDEEQKSERDQRLCSISLTKTKKRSVQQKKVS
DVISSFGDLKRDQKEHNVQKNIGNYESTQSYMSSEDGDGKKKRNTVDQKAVDNVMCQGPP
LNFIENSSSLNQYDNVDANEATDIVKINTSKSKFLNQKCPKKPGLQKTGDDTCGVNFPKK
SKRRNKEETSPRTDPPVILRFDSDLWLHDTSPGSLDSDNDDQLDSYQKWKKSVPKMFKSQ
VVPRPLKDPPTSTNQSTWSDTKFEPVKESPRPLKDPPDSWMEDVNWRRMQEEYRPRKDPP
SPYCQHGHRNLLGCLQSTQFLPTPMSTVSS
Download sequence
Identical sequences E3NCN6
31234.CRE21526 XP_003093821.1.11157 CRE21526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]