SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE21781 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE21781
Domain Number 1 Region: 738-771
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000558
Family Retrovirus zinc finger-like domains 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE21781
Sequence length 1212
Comment (Caenorhabditis remanei)
Sequence
MDKYASSFSTKTVFLTASRTPFPSVSTIVTFGPHFIGIILILQTCLHNSRTQCSCALAHC
IYSLARTWKLYHHREKMADIEEEEAKRLAEEERIRQEEANRLAEEERIRCENELLAEEPM
EEGDEDKRVQEVRLAEIEKVINKTCIDIKNQTKFSTKQCRVLLSPLIGKILEVEEEFRGK
KKESEFWENTNVKLNKTVLSLQNELEAKGQQKPPTSLEEPTATSVLSGQSTQGKQERIKL
VSLLEANEIHTEDELNKLFEKYEHLEYELSVKVEYLQRSQRQTDLFRSELCRLKVKCDQQ
QQKLLAEEEKVKKMSEELKVKHSTHSANSATRFGECNQQTGERKESTRYYNAETSEIIDT
IPLQESLDSGRNWNQRIVEQNSQRNIIVHNEHEMSSMNTQWRMTQALPDPPVFSAGKNSV
NAETFERAFYMKYRFFDIEAQKNFLETRFLSGNALTVYKGLPESDKNSVSRILDAIKRRL
SQSEPEESRRAKSKFQALKLHKEQTVQDYCLIMDEVVRIGYKGVPEYQISSMKTTKLLDE
MREHTIFEVLLQILGSQLRNCPVEEQYEFCRVEATLFDEEWRSGRKKVAQKERGMNRQQS
DQPANNLQRPGSTQNSAFVPQQYSRRNRYTPNSQSNSYQTNSLAESSNNQCTSTTGQQQN
FSTSTDLTNQYAQKTDQQNQGPKGYVYNEKSPECWKNLVHSSDSANNASSSALGFHECSE
CSLTGCHAPTCSRAPGSNTSKVKMNSTIVCFRCDQQGHIASKCPTRNASIQEVRMAPEIQ
SKVEDQKFKMKSDTKCSSDKESERELIDHEMETKDLCEGQSVAASVFKKDMVIDVDRVPI
KSINSIEFSVISSDEMLRSGDTRDDGLQTSCTKHAHTKDNNVGVNREFTEANSQKNGNCD
EEQKSERDQRVCSISLTKTKKQSVQQKKVSDVISSFGDLKRDQREHNVQKNIVNYNSMQP
SMSSKDGDGKKKRNTVDQKAVDNVMCQGPPLNSIEDSSCLNQYDNMDATEATDIVKKNTS
KSKFLNQKCLKKPGLQKTGDDTCGVDFPKKTKRRNKEETRPRTDPPVSSLETSDYDYNSV
FCYDSEIWLNDTSPGTLDSDNDDQLDSYQKWKRTVPKMFKSQVMPRPLKDPPVSTNQSTW
SDTKFKPVKDSPRPLKDPPDSWMEDVNMRRMQEEYRPRKDPPSPYCQHGHRNLLGCLQST
QFLSTPMSTVSS
Download sequence
Identical sequences E3MEF7
XP_003105389.1.11157 31234.CRE21781 CRE21781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]