SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE22308 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE22308
Domain Number 1 Region: 357-787
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 8.12e-123
Family Reverse transcriptase 0.0000852
Further Details:      
 
Domain Number 2 Region: 967-1123
Classification Level Classification E-value
Superfamily Ribonuclease H-like 9.99e-42
Family Retroviral integrase, catalytic domain 0.0044
Further Details:      
 
Domain Number 3 Region: 219-313
Classification Level Classification E-value
Superfamily Acid proteases 0.0000000000000668
Family Retroviral protease (retropepsin) 0.015
Further Details:      
 
Domain Number 4 Region: 154-198
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000492
Family Retrovirus zinc finger-like domains 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE22308
Sequence length 1279
Comment (Caenorhabditis remanei)
Sequence
MLKSILILQIVFSQRFQMHSVSPISFKSSKRRSSRQAPFSGNDKIFSERNTNGSAIEEYT
GLVLRRFTSSEFKKMSDDQICCMVWINGLRDNSYSDIRTKALQVMEAKPNCTLLELEQDI
KRLLDVRADSKSVSKVEAVSNEINAIHNAIKRDKSQKAPPSPCYKCGGSHWAKECSKKVT
CSNCNKNGHIAKFCRSKQRDSSKVNKKVRSVVISTASTSGSSRIYRIISINGKKIQMQLD
TGADVTLISVKDWNRLGRPQLQAPSIKVKSANHQPIAVKGSFQCNFIINGNSATGHAHVA
ETGTLLGTDWISKDTKLWQLLNNNQVNAVRSDVGSACDYLDGSREQLKIDLKKEFDPVFQ
PGLGLCTKTKASLLPKPDAHPVFRKARPVPYAALTTVSDELERLQQAGVISPVDHSEWAA
PIVLVKKKNGSLRMCADFSTGLNEAIQQHQHPLPTADDIFSTLNGGKYFSQIDLAEAYLQ
IEIDEQAKQMLCINTHRGLYRYNRLPFGVKSAPGSFQQIMDSMTSGLDGVAAYLDDIIIT
GSSVAEHNQRLKTVMSRIQDFGLRVRIEKCTFLSPKITFLGFIIDKDGRRPDPEKVSAIR
HMPVPQNESQVRSFLGLIQFYGSFVKELFKLRPPLDALTKKDVEFKWTSECQNAFDHIKQ
ILHSDLLLTHYDPKLPIIVAADASQYGIGAVISHRFPDGSEKAIYHISKALTAPQRNDSQ
IEKEAFGLITAVTKFHRFIHGRHFTLRTDHKPLLSIFGEKKGIPVYSANRLQRWAIILLN
YDFNIEYINTHDFGQADALSRLISEQIQQKECEDRVIAQIESEVVTNLVSTCEQLPVTAD
MVRSYSRKDKLLADVFQYTISGSWPKIIEKNSQISLFHNRRDQLSIVSDCLMFNDRVVIP
TSLRTRVLKMLHRAHPGIVRMKQLARTLVYWPSIDKDIEKIVRSCDQCAAVAKDPVKNTL
CSWPISTAPWQRVHIDYAGPIDGTYFLVIVDAYSKWPEVIPTTSITSTATINILRKLFAQ
FGDPETLVSDNGTQFTSTQFDEFCKQRGIRHTRSPPFHPQSNGQAERFVDTLKRALGKLK
GEGTTDTALYLFLQSYRSTPCTASLNGSTPAENFIGRKIRTYLDQLLPNDQLTVSHDTEM
EEQFKKQHGARPRNFQKEEKVYVKDYRNINTASWIPGTIQSRIGKTLYKVFVNDTTWIRH
SNQLRRRDDPIKDVPLDTLDLMDFMPSSTTHPDSSNSATPKVKTPVKPRTPSPPTLRKST
RNVKSPSKFIVKPSLKSYR
Download sequence
Identical sequences E3ME16
XP_003105474.1.11157 CRE22308 31234.CRE22308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]