SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE22626 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE22626
Domain Number 1 Region: 1209-1643
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.07e-133
Family Reverse transcriptase 0.0000336
Further Details:      
 
Domain Number 2 Region: 1855-2010
Classification Level Classification E-value
Superfamily Ribonuclease H-like 9.36e-37
Family Retroviral integrase, catalytic domain 0.012
Further Details:      
 
Domain Number 3 Region: 973-1073
Classification Level Classification E-value
Superfamily Acid proteases 0.00000000274
Family Retroviral protease (retropepsin) 0.031
Further Details:      
 
Weak hits

Sequence:  31234.CRE22626
Domain Number - Region: 177-207
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000209
Family Retrovirus zinc finger-like domains 0.0042
Further Details:      
 
Domain Number - Region: 1096-1183
Classification Level Classification E-value
Superfamily dUTPase-like 0.0085
Family dUTPase-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE22626
Sequence length 2243
Comment (Caenorhabditis remanei)
Sequence
MKDTLTNDKKKAVFLTYLSDFARDKAEELLESKPDALFEDLVEHLKSTFQDPTRAEMERQ
QLRQCSQHQDESVDAFGARVRKLAQPAYVGKSREYIADKAKEAFIDGLTFTLKFHVKGES
PRNFQEAQNSALKFELLLAEAAKANTITPQGLSFAPPPQNTPSQPAQPPQSAYQHQQPNF
PPPPRRTVCYSCGYEGHYAADCRRRQGNHYQNRDPRNNNRGYRSNNNGGYRNNGDSRGNN
GGYRNQDGGQRQQFPVNDPVQRHQIPSPQQEQHRRFVNSLAPTENPLVEQLRTELATSRA
QLDALVQRNSELATAASTASPSRRINCVSRASYILSICALATFLSLMGSASALEPLVCMH
YAPESYVQVPSPLDCTIANTMTTTARATPLELAIFRDNTINYRTNGTLCKVVKQVTTFSV
NIFGARFQESSSKQLPVSTEACANMVKFQECEFGELHHRAGIFKTENAHIINWPSAFNIF
AGTQVVETTNCFMMPTSVYSRFGSETPSSPAGSLVGCRFSDGSCTTRGGATFIWTPTQDQ
QCRFVFWKKLRGVQSGRIWLSEDKEFALSFLPNNSRIADCGRKIVVTDQGYGIVLPSRTK
RQAEGLNELTNFVTSNQLAAQLLANEEAVLESASKLVKFGYKNLCHASNSQRAMVLSAVV
SNPTMAARKLTGKDQIKAKFLGEGFLAIKTCSVIPKGSFEFISFKETCYSKPSVRVTTPA
NSTIVTFVDLTTRIITNRAHPVDCNLMANFEYVVNGTLFSLNPFTLELKTHPDFRARQIS
ETPVFQNQIGEETPLIFHNLIIGSLSENMPEAHYNEIWEAMQGSPEALTRIVSAHSDPSS
GPLLATQIEEAFDLWERIKSVGRVIFVIWTVVCNTVITILTLVAIIAGVARFYIGPWLVS
LKRTEPKATQFIGTGADVQSPAAETPVVSPQETPRIQNKLAGPIPDCARQMKRLRSPASL
LSYTDPKYFTAQIPIRVNGIHFWALVDTGAGFTVAGREICALIGVGKLNPPTVDHALGLG
GNEVGMAGSATIKFEIGANTIFQTTNFTTGQCCPEGVSNYDFILGNDLLSRLPKFFLDYP
NKCFEVGDEKLPLGSPKMETVFPYRYKVHVAKNTVIPPRSEAFVKCVVPLCQEEKDLVLL
SQANSLVAQDLIVAPAIFVPSKAFLLVTNPTNEPKTLYANTTAATATDFVVDLSHAKLSD
VEREILLSLLEEFHDVFSKNAYDLGSSKTEPVHIYTNTEVPIRGRPSRVPVKYQAELEKH
INSLLRSRRITESNTPWTSPIVIVTKKNGSLRVCLDFRKLNEATIPDNFPLPRIDAILEK
VGGSNFFSSLDMANGYLQLRLDASSSYKCGFITENKVYAYTHLPFGLKSAASYFQRALRT
VLSGLEEEVLVYIDDILVFSKTFEQHVISLRKVLQRFRDFNLKASPKKCEFAKKAITFLG
HEIGKDSYSPDKANVAKITEFPVPSNVNEVRRFVGMAGFFRKFIPKFSEIAEPLTRLTRK
ELKFTWDSAQQAAFEKLRTALASEPILGFPDYDKPFHIFCDASAVAQGAALMQTRPESEK
DFYGIAYASRTLSDPETRWPAIQVEMGAIIFALRQFKPYICMSKIILHSDHKPLTFLLQK
AKAHDNLSRWLIELQCYDIHIVHIDGKKNTVADCLSRARENESLEELTELKDIIDFPICM
TLALPDPQTDHTNRATGPVGIGSLVVSQRKVHLTRKNQPTISLDFAAEQEKDSNILIVKK
ILKNQSPEDSVPEPLASRLTLSELAPNGTVLTKPYGFSKRALPWVPAHLTSLIFEAFHES
YLSGGHFNGMKTRVKIERRYFWPGMAKEIWAKCKACLKCQAKNSPVPAYRERLRTVVTTK
VFQKVGVDLTGPLRTTPWNNKYILNIVCWFSKFIVSVPLSDARSDTVARALLNECVLKYG
AMTELVSDNASTFTSHAFGSFCQLLSVRHHYAIPYHSKGNGATERSFRTFHQLVSKYVNK
SHTDWDSILPAITFCYNTTVHSTTGETPFFLMHGRDPTFGIDRIIDPTPAQLSSGDDNIE
NFRQELIANLREAWFHAKEQADKARTLFARTYDAKTRPSEIIVGDRVLFKNYLSKKDLSR
KLVLPWVGQYRVLEVTPPEAVIQDICSPKKAPRRVHLDQIKKFVEITGPAATDRDEGPDS
DEEAEQDVQVAQGDQVEAKGIDTTTEGEVRPLETVPEEDLDQSTEVNDNCDFPPTEGDEQ
QHRYNLRRNRNPPERFEAKFERR
Download sequence
Identical sequences E3N8T2
CRE22626 31234.CRE22626 XP_003095217.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]