SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE22890 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE22890
Domain Number 1 Region: 888-1322
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 8.01e-133
Family Reverse transcriptase 0.0000335
Further Details:      
 
Domain Number 2 Region: 1513-1666
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.66e-36
Family Retroviral integrase, catalytic domain 0.01
Further Details:      
 
Domain Number 3 Region: 647-748
Classification Level Classification E-value
Superfamily Acid proteases 0.0000000000113
Family Retroviral protease (retropepsin) 0.019
Further Details:      
 
Domain Number 4 Region: 503-543
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000171
Family Retrovirus zinc finger-like domains 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE22890
Sequence length 1871
Comment (Caenorhabditis remanei)
Sequence
MSNSPPPPLRPLSWSTQKAADRVVDGTKVTGQHLAAVKLAIGKDLTATWDAIEAIQAEQR
TNSTLLTGQVNRAIFEAGRANRLVDLLASKIESLERKVSETCLCSGVVDMVGKWDDHRVI
SPTTPTSPRARSLSLNRGLRPQILHTPVVVRQQGVSRDESAADMDLSQRPIDAGESIMEN
SHPLMANNLTPIRIGSPQLEEGENESILHANLDNTVRYEVYVSTPNERNEEDPTPEDVQT
AGTASGGPTPPGSTPQLRLNDGNIPNVQELITSEDNEDKEEEFVPYVMALSFKSAAPLPS
YGGTSHEDFNSFVRSFKDRVVAIDAEASQEDLKRAFLTVLKDQARDRAESILTEKPEATF
DDLVKGLKEMFECPSHVQRSKAQLRSSKQLPHESAEVFFHRVSKLAKQSYGSNISFQKEV
TLEQFLNGLHPNIKTPVMLRSPPTPEQALSDALAVEACLAPAEQPPHGSQLSPELVASLT
NMVIDYEQRGNRRDDSRRRDDSRDGRHHNRRGNSTYFRGNCYYCGKFGHSTKDCRQKKKD
QEDGIIRQGTGAPRNPVSNHRVGGRAEVNTVGREDENTTLRRAIQERDEQIQELSRRLNG
NGYYSSGGNTSVSMLYWPSQPSEQEPHVQQAVHNFQHVGSERITAQVPIKANGYTCNALI
DTGANITIAGANTRKFLRIPKLTKTPFDHAYGLGGNEVRMEGYADIYFQIGSHNIIQRTY
FTVGKCTPVNPHGYDFIFGNDLLSRLPTFFFDYNNACFHIGEDILPLGPSRQGTTVPVQF
DIKTAEDTVIPPRSERIVKCTIPMELSRMSELTILAVPPRLPGEELLVAPSVMSSSNVAV
MITNASEEEVTIQSKTKAVALDDDPEFRIDLSKTEGISAIEKAALQALLDSFSDVFSRNP
YDLGSSKTEPVHIYTSTEIPVKGRPYRVPVKYQAELEKHINGLLRSARITESNTPWTSPI
VLVKKKNGSLRVCLDFRKLNEVTIPDNYPLPRIDTIIEKVGMARYFSSLDMANGYLQLRL
DAESSYKCGFITENKVYAYTHLPFGLKSAASYFQRALKTVLAGLEEDVMVYIDDVLIFSK
TFEEHLVSLRLVLARFREFNLKASPKKCEFVKQSIVFLGHEISGVSYSPNQANIDAIAKL
PTPTNVMELKRFVGMAGFFRKFIENFASIAEPLTRLTRKEQKFVWSQEQQEALTKLKTAL
TSKPILSFPNYEKPFHIFTDASAVAQGAALMQAAEADPKNFHVMAYASRTLSDEETRWAA
IQIELGAIIFALRQFKPYICLSKVILHSDHRPLTFLLAKNKVNDNLARWLVELQQYDIEI
VHIEGKKNTVADCLSRAKDEIAPLDNQELEDIIDFPICMSARPLVPSENQILTLAGNSNP
INLITEQDMDKDILIIKTFLQNPATPIDRLSDQWSDVLELMQISSKGFLVIVFQGIPRIV
IPRQLRSLIFDSFHTNVMAGGHLNWRKSLQKAQRKFFWPNMKADFFRWYSECVPCQQKRQ
PHPSTRQPQSVVITTRIFEKVGVDLAGPLKTTTRLHKYYINIICWFSKFVISVPLPDATA
ETVARVILEECVLKYGTPTEIVSDNGPCFSAAAFKQFCNMLSIGHHLAIPHHSRGNGATE
RTFRTFHQMTSKYVNPTHTNWDTILPCVTFAYNTAVHSTTGETPFYLMFGRDPTFVIDKI
LDPSPSGFTDEDVRDWATHITTTLRQAWKDAAEHSLKVQEQIQARANDGAKGSDIQPGDR
VLMKNYESKVGLSRKLVLPWIGDYRVLEVSENEALIQNLKKPDKAPKRVHLDQIKKLVLP
EAAVERAEPGAELEVKKMSEKTSTKPKSVKSAEDVVKPAGSGRQAEPTPTQPPVGRRNPP
RKRNPPKRLGG
Download sequence
Identical sequences E3MHE3
XP_003104418.1.11157 31234.CRE22890 CRE22890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]