SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE22892 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE22892
Domain Number 1 Region: 462-894
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 6.89e-125
Family Reverse transcriptase 0.000044
Further Details:      
 
Domain Number 2 Region: 1074-1228
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.64e-39
Family Retroviral integrase, catalytic domain 0.0081
Further Details:      
 
Domain Number 3 Region: 325-419
Classification Level Classification E-value
Superfamily Acid proteases 0.00000000000006
Family Retroviral protease (retropepsin) 0.014
Further Details:      
 
Domain Number 4 Region: 257-302
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000314
Family Retrovirus zinc finger-like domains 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE22892
Sequence length 1386
Comment (Caenorhabditis remanei)
Sequence
MATVEEQLASLTQAVAQLVQLQTTQAQAQTNATAPATPTAPRLFDQISNRIPQFQYDPEM
EKTFDQFYSRYKDVINKDGHQLSDEEKTRIVLSKISDSDYTYYSNRILPKLPVDFNYSDT
VNKLKDTFKSTSSIFKKRQEFLRLEFDGTKLEEYTGTVLRKFTAAEFKKMTDDQVCCMVW
ISGLRDERWTDMRTKALQTMESKPNITLLELEGEVKRLLDIRADSMSITAPSTGINLVQK
HSQRNQRQTKHQPNPKSETAPSKPCPGCGGTHWLKDCKNPRKVKCRYCKRAGHLETDCRT
KQRNQNKKGAESTINSVVIQAATTSGSNRIYRTVVVNDKPIKMQFDTGADVTLFHESDWI
KLGRPQLHKPTITVRSANNQPILVKGWFECNVTIGKDAHVLKAHVAETKTLLGIDWMARD
QQLWNTLNGSEQINLVGSLTGSACDFLDGAREQLKRSLENSFPQVFQPGLGKCTKMKAEI
KLKPDAKPVFRKCRPVPYATLSAVSEELDRLTLQGVLTPVDHSSWAAPTVTVKKKNGSIR
MCADYSTGLNDSIEQHRHPLPTADSIFTSINGGKYFTQIDLAEAYLQMELSDDSKELLCI
NTHKGLYQFNRLPFGVKSAPGIFQQLMDQLINGIEGVASYLDDVIVTGSTVSEHDDRLMK
VMSRINEFGLKMKLEKCNFLMQEVRFLGFIVDKNGRRPDPEKIAAIKNMPVPKDVSQVKS
FLGLIQFYGAFVKSLFRLRPPLDALTKKDTPFRWSRACQNAFDQIKEVLQSDLLLTHYDP
NKPIIVAADASQYGIGAVLSHRYPDGSEKAVFHISKSLNKAQQNYSQIEKEGFALVTAVT
KFHKYLHGRSFILKTDHKPLLSIFGDKKGVPVYSANRLQRWAVILLNYHFKIEYVNTMSF
GQADALSRLIAENADSKEPEDHVIAQVELDITDTFAQGCKQLPVNAHTIRSYSRKDTTLQ
EVYKAIQTGQWPKSVPKNSPLWEYYNRREDPYIVQGCIMFGERILVPPTLRNRVLKMLHR
AHPGIVRMKKLARGFVYWCGMDADIQKMVQSCDQCAAVAKGPVKTTLCSWPMPTAPWQRV
HADYAGPIHGKYYLVMVDAFSKWPEIRPTTSITTSATLKLFQHVFSQFGIPDTLVTDNGS
QFTSSAFNEFCKSQGINHIRSPPYHPQSNGQAERFVDTLKRALGKLKGEETDDTALNIFL
QNYRSTPCDASPNHVTPAENFIGRRIKTFLNQLLPSSAPVSSDYNHKMEDQFNRQHGSRT
KEFAPHDKVYVKSYRNLSATTWTSGVIICRLGKTLYSVRVNDNTTWKRHANQLRRRESPP
AAKTIPMDLIEGKNFEEPKLSQDVHTQQLSPPRATPAHHSNTVSCRRASPLQSSISPTRP
SHHGPV
Download sequence
Identical sequences E3MHE6
31234.CRE22892 CRE22892 XP_003104360.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]