SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE23121 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE23121
Domain Number 1 Region: 561-655
Classification Level Classification E-value
Superfamily Acid proteases 0.0000000000398
Family Retroviral protease (retropepsin) 0.036
Further Details:      
 
Domain Number 2 Region: 461-491
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000314
Family Retrovirus zinc finger-like domains 0.0022
Further Details:      
 
Domain Number 3 Region: 747-775
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000227
Family Retrovirus zinc finger-like domains 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE23121
Sequence length 878
Comment (Caenorhabditis remanei)
Sequence
MVARPTRFIGVEVYSLVHRNFILPAPAIRLVPDKRRTPMVIRHQVSFGGGTTSVRRRSFA
EVVIGASRPQFRAFSGDAKRTGDPMQFREESIALVSSIREGSSVLVSTIREESDVLVREG
SDNWHSPICEKSCEMDPWHRDESRGLDTPYSINTEVRSSVSSGIGKQVSPVVTATICEGS
DTDAVASDNVKGCYENILTELCSNSETHPRVMTISLVDDAVIVSKQEAESDHVTSSGNED
RKQCSHMHSTPHVMMISLEDDVRLSRYSGSDNEDLAEFVRSFEDKFAITGKDDNVKGKFF
LAYLKEDARDTVQEVLDNNKNSTFDQLVESLKKRFMNPALNDRFKQQLRSRTKRTGETVE
EFYRGVTRLVKRIHNSTSSAVAKDAILDQFLYGLDDNIMKMHVKLSKPKTPQDALETALS
VEGVMTITKHTDVLSNPRVLAAIAGKVPNRDNSLRESDDVRRSSVSSQQCYYCQEEGHYA
WQCPEKARRHHQPGSSRAQVGCIHVNAKQRLERLTDQEHEGNFRSECYTLQCRYENAQKG
PSCNAEYKDFGAPASIISASIPIEANDYACLALVDTGATITLTSGVMCSRLGLPEPEAPL
KKTVIGIGNASVKIAGSRVITFTIGSYRINHRVHITAEPLGDYDFLLGIDLLFRLPNIGF
DLREAKMSIGKDVLPLGERAKCQECQRRSLENKTLKVQKSSWSEEAHEGTYTDFVIVDSW
AEEMESSQVQEAVESKPSKLTKRPKLQSTPRRKGTCHYCKEEGHFARECHKKAKLVASKK
DQRPNPPTILDRGEDISSSHTQLAQEIETLRKQVEELLVQNRKLISERFTSCEHTRAAPQ
QSTEVEKTEVEVEKTEEEQNVTSSSHCDQEQKDRQSSM
Download sequence
Identical sequences E3ND15
31234.CRE23121 XP_003093684.1.11157 CRE23121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]