SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 31234.CRE23282 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE23282
Domain Number 1 Region: 470-896
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 6.78e-125
Family Reverse transcriptase 0.0000773
Further Details:      
 
Domain Number 2 Region: 328-422
Classification Level Classification E-value
Superfamily Acid proteases 0.0000000000000317
Family Retroviral protease (retropepsin) 0.0097
Further Details:      
 
Domain Number 3 Region: 1076-1134
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0000000127
Family Retroviral integrase, catalytic domain 0.031
Further Details:      
 
Weak hits

Sequence:  31234.CRE23282
Domain Number - Region: 267-309
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000753
Family Retrovirus zinc finger-like domains 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE23282
Sequence length 1135
Comment (Caenorhabditis remanei)
Sequence
MADVTTGDQIKQLTEQINTLVGVVSTLAKNQAQFQNSGNTETSTTTTNDSKMFDSICARI
PMFVYDAEEEKTFDNWYTRYEEVIIKDGASLAEDLKTRIVLSKLCQKDYALYTNRCLPKL
PNEISYSDTIKNLKALFKSTTSIFRKRQEFLRTEFGGGSLEEYTGTVLRRFATSEFKKMT
DEQTCAMVWIAGMRDPSYQDIRARALQVLEQKPNLTLLELESDVKRLLDIRADARAVGGS
VATTSDVNAVQKFQKSKKNTPEKKDSKQPPSACYRCGGNHWVRDCEHKKVTCSYCKKPGH
LEKCCRSKNRENKSPKVKTVYIGAASIDGAERIYRQVQINGHYVKMLLDTGADITLLSRN
DWTTLGRPKLEKPAIKVKSATHEPVKIFGSLHCKFMMNGRQESGVAYVSNTDTLLGRDWI
SKDKELWKFLQTPEKINRVSVTESACNYLGGTRERLIEAIGTKYKEIMKPGLGKCTKTKA
TLTLKPNARPIFRKARPVTYSALPMVSTEIERLTQTGVISPVDHSEWAAPVVAVKKKNGS
IRLCADFSTGLNDAIESNNHPLPTADDIFAKLNGGNFFTQIDLAEAYLQVEMDPDSQKLL
VINTHLGLFTYNRLPFGVKSAPGIFQQIMDTMLNGLEGVSTYLDDIIICGSTIEEHNERV
LKVFGRIQEYGFRIKMEKCSFLMEEIKFLGFIINKQGRRPDPEKVRHIKNMPEPTNVSQV
KSFLGLIQFYGQFVKQLFRLRQPLDNLTAKDTDFKWNRECQKSFDTIKEILQSDLLLTHY
NPNLPIIVAADASQYGIGATISHRCPDGTEKTIYHISKTLSKTQRNYSQIEKEGFGLITA
VTKFHKFIHGRKFTLRTDHKPLLTIFGGKKGVPVYTANRLQRWATILLNYDFDIEYINTK
DFGQVDALSRLIDEQNAEKAPEDFVIAQVELDPVDQLPQNLSFLPITAKTISFQTGKDTL
LTDVLNSLKSGKWPKSEKGTEMWNMCNRKDEFSIVNDCIVLGERVVIPTVLRQKVLKTLH
RAHPGIVRMKMLARSYVYWPGIDKDIEKLVKSCDECASAAKNPVKNLLYSWPIPKKPFER
VHVDFAGPVDGMYYLVFVDSLSKWPEVYATTSTTTAATIKILAKVFGQFGNPETL
Download sequence
Identical sequences E3NV49
CRE23282 31234.CRE23282 XP_003087722.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]